KEGG   Planktothrix agardhii: NIES204_06120
Entry
NIES204_06120     CDS       T05658                                 

Definition
(GenBank) succinate dehydrogenase subunit C
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00190  Oxidative phosphorylation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_06120
   00650 Butanoate metabolism
    NIES204_06120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES204_06120
SSDB
Motif
Pfam: CCG
Other DBs
NCBI-ProteinID: BBD53348
UniProt: A0A2Z6CAA4
LinkDB
Position
complement(737652..738611)
AA seq 319 aa
MMEDKGHFSMPLLFVEKVISMPSLRYAYFPGCVAQGACRELYQSTQVLTQALGIELIELK
KASCCGSGTFKEDSRLLEDTVNARNIALAEELNLPLLTHCSTCQGVIGHVDERLKEFQEN
DPAYIEKVNGLLSKEGCSPYQGTTEVKHLLWALVADYGLAEIERRVRRKLSGLKCAAFYG
CYLLRAQTHLPYDDPQQPESMENLFRAVGATPVYYRGRTQCCGWPLSSYATESAFQMAGN
HIQEAIDHGADCLVTPCPLCHLNLDSRQPEVEKVIGRPLGLPVLHLPQLVALALDIDPKQ
LGLDRHVVSTKSVLDKIRA
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatggaagataagggacacttctccatgcccctgttgttcgtagagaaggttatttct
atgccatccttgagatatgcctattttccgggttgtgtagcccagggagcttgtcgggaa
ctgtatcagtctacgcaagttctcacccaagcgttaggtattgaactaattgaactgaaa
aaggcatcttgctgcggttcaggaaccttcaaagaagattcccgactgttggaagatact
gtcaatgcccggaatattgccttagcagaagaactaaatttacccttactgacccattgc
agcacctgtcagggggtaattggtcacgttgacgaacggttaaaagaatttcaggaaaat
gatccagcctatattgaaaaagtgaatgggttacttagcaaagaaggttgttcaccctat
caaggaacaacggaagttaaacacctgctgtgggccttagtcgccgattatggtttagcc
gaaattgaacgccgagtccgtcgcaaactatcgggtttgaagtgtgctgccttttatggt
tgctatctcctccgtgctcaaacccatttgccctatgatgacccccagcaaccggaatcc
atggaaaacctgtttcgggctgtaggggcaactccggtctattatcgggggagaacccaa
tgctgcggttggcctctatcgagttacgccacggaatccgcctttcaaatggctggaaac
catattcaagaggcaattgatcacggtgcagattgtctggttacgccctgtcccctgtgt
catctgaatttagattctcgtcaaccggaagtggaaaaagtgatcggtcgtcccttgggt
ttacccgtcctccatcttccccaattagtggcccttgccctggatattgaccccaaacaa
ctgggtttagaccgccatgttgtttccacaaagtctgtgttggacaaaattagagcctga

DBGET integrated database retrieval system