KEGG   Planktothrix agardhii: NIES204_06120
Entry
NIES204_06120     CDS       T05658                                 

Definition
(GenBank) succinate dehydrogenase subunit C
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00190  Oxidative phosphorylation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_06120
   00650 Butanoate metabolism
    NIES204_06120
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES204_06120
SSDB
Motif
Pfam: CCG
Other DBs
NCBI-ProteinID: BBD53348
UniProt: A0A2Z6CAA4
LinkDB
Position
complement(737652..738611)
AA seq 319 aa
MMEDKGHFSMPLLFVEKVISMPSLRYAYFPGCVAQGACRELYQSTQVLTQALGIELIELK
KASCCGSGTFKEDSRLLEDTVNARNIALAEELNLPLLTHCSTCQGVIGHVDERLKEFQEN
DPAYIEKVNGLLSKEGCSPYQGTTEVKHLLWALVADYGLAEIERRVRRKLSGLKCAAFYG
CYLLRAQTHLPYDDPQQPESMENLFRAVGATPVYYRGRTQCCGWPLSSYATESAFQMAGN
HIQEAIDHGADCLVTPCPLCHLNLDSRQPEVEKVIGRPLGLPVLHLPQLVALALDIDPKQ
LGLDRHVVSTKSVLDKIRA
NT seq 960 nt   +upstreamnt  +downstreamnt
atgatggaagataagggacacttctccatgcccctgttgttcgtagagaaggttatttct
atgccatccttgagatatgcctattttccgggttgtgtagcccagggagcttgtcgggaa
ctgtatcagtctacgcaagttctcacccaagcgttaggtattgaactaattgaactgaaa
aaggcatcttgctgcggttcaggaaccttcaaagaagattcccgactgttggaagatact
gtcaatgcccggaatattgccttagcagaagaactaaatttacccttactgacccattgc
agcacctgtcagggggtaattggtcacgttgacgaacggttaaaagaatttcaggaaaat
gatccagcctatattgaaaaagtgaatgggttacttagcaaagaaggttgttcaccctat
caaggaacaacggaagttaaacacctgctgtgggccttagtcgccgattatggtttagcc
gaaattgaacgccgagtccgtcgcaaactatcgggtttgaagtgtgctgccttttatggt
tgctatctcctccgtgctcaaacccatttgccctatgatgacccccagcaaccggaatcc
atggaaaacctgtttcgggctgtaggggcaactccggtctattatcgggggagaacccaa
tgctgcggttggcctctatcgagttacgccacggaatccgcctttcaaatggctggaaac
catattcaagaggcaattgatcacggtgcagattgtctggttacgccctgtcccctgtgt
catctgaatttagattctcgtcaaccggaagtggaaaaagtgatcggtcgtcccttgggt
ttacccgtcctccatcttccccaattagtggcccttgccctggatattgaccccaaacaa
ctgggtttagaccgccatgttgtttccacaaagtctgtgttggacaaaattagagcctga

KEGG   Planktothrix agardhii: NIES204_06780
Entry
NIES204_06780     CDS       T05658                                 

Definition
(GenBank) putative succinate dehydrogenase flavoprotein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00190  Oxidative phosphorylation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_06780
   00650 Butanoate metabolism
    NIES204_06780
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES204_06780
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NIES204_06780
    1.3.5.4  fumarate reductase (quinol)
     NIES204_06780
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 GIDA Pyr_redox_2 Lycopene_cycl FAD_oxidored
Other DBs
NCBI-ProteinID: BBD53405
UniProt: A0A2Z6CAG5
LinkDB
Position
822922..824649
AA seq 575 aa
MLEHDVIIVGGGLAGCRAAVEMARTNPSLNIAIVAKTHPIRSHSVAAQGGIAATLKNIDE
SDSWQAHAFDTVKGSDYLADQDAVEILAKEAPDVIIDLEHLGVLFSRLPDGRIAQRAFGG
HSHNRTCYAADKTGHGILHELVSNLRRYGVHIYDEWYVLRLILEDGQAKGVVMFRIDDGQ
LTVVRAKAVMFATGGYGRAFNTTSNDYASTGDGLAMAAMAGVPLQDMEFVQFHPTGLYPV
GVLISEAVRGEGAYLINSNGERFMATYAPSRMELAPRDITSRAITLELRAGRGINPDGSA
GGPYIYLDLRHLGREKIMSRIPFCWEEAHRLLGIDAVVEPMPVRPTVHYSMGGIPTNING
QVLSGADSFVDGLFSAGEAACISVHGANRLGSNSLLECVVYGKRTGAAIAQFVQNRKLPN
IDEQRYLKETALQLQGLLDQSGDYRIGKLRQEFQDAMTSHCGVFRTDTVMREGLSQIQEL
QNRYQRIYLDDKGKCWNTELIEALELKSLMIVGNMILTSALSRQESRGAHSREDYPQRHD
ETFLKHTLAYYSPAGIDLAYRPVKITLFEPQERKY
NT seq 1728 nt   +upstreamnt  +downstreamnt
atgctagaacatgatgtgattattgttgggggcgggttggcaggatgtcgggcggccgta
gaaatggcccggactaaccccagcctgaatatagctattgttgccaaaactcaccccatc
cgttcccattccgtcgctgcccaagggggtattgctgccaccttaaaaaatattgatgaa
agtgatagttggcaagcccacgcctttgataccgtcaagggttcagactatttagctgac
caagatgctgtcgaaattttagccaaagaagccccggatgtaattattgatttagaacat
ttgggcgtattattttcccgtcttcccgatggccggattgctcaacgggcttttgggggc
cattcccataatcgcacttgttacgctgctgataaaacaggtcatgggattttacacgaa
ctggtcagtaacctgcgacgctatggtgtccatatctatgatgaatggtatgtgctgcgt
ctgattttagaagacggacaggccaaaggggtggtcatgttccgaattgatgatggacag
ttaaccgttgtccgggctaaggcggtgatgttcgccaccgggggctatggtcgggcattt
aataccacttccaatgactatgcctcaaccggggacgggctggcgatggcggcaatggcg
ggggttcccttgcaagatatggaatttgtccagttccatcctacgggactatatccggtg
ggggtgttaatttccgaggctgtgcggggggaaggagcctatttaattaatagtaatggg
gagcggttcatggcgacttatgccccgagtcggatggaattagcacctagggatattact
tctcgcgcgattactttagaactgcgggcaggccgtggaattaaccccgatggcagtgcc
ggggggccctatatttatttggatttgcgacatttaggacgggaaaaaattatgagtcgg
attcccttttgttgggaagaagctcaccgtttattaggaattgatgcggtggtggaaccg
atgcctgtacgtcccacggttcactattctatgggaggtattcccactaatattaatggt
caagttttaagtggtgcggatagttttgttgatggattattttccgccggagaagccgct
tgtatatcggtgcatggagctaatcgtttaggcagtaattctttattagaatgtgtggtt
tatggaaaaagaaccggggcggctattgcccaatttgtgcaaaatcgcaagttaccaaat
attgatgaacagcgttatttgaaagaaactgcattgcaattacaaggtttattagaccag
tctggagactacagaattggaaaactgcgtcaggagtttcaagatgctatgacctcccat
tgtggtgtatttagaaccgatacagttatgcgagaagggttaagtcaaattcaggagtta
cagaatcgttatcaacggatttatttagatgataaaggcaaatgttggaatacagaatta
attgaagcattggaattaaaaagtctgatgattgtaggaaatatgattttaacttcggcc
ttaagtcgccaagaaagtcgaggcgcccatagtcgggaagattatcctcaacgccatgat
gaaaccttcctaaaacatactttagcctattattcccctgcgggtattgatttagcctat
cgtccggtaaaaattaccctatttgaaccccaggaacgtaaatattaa

KEGG   Planktothrix agardhii: NIES204_10430
Entry
NIES204_10430     CDS       T05658                                 

Definition
(GenBank) putative succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00190  Oxidative phosphorylation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_10430
   00650 Butanoate metabolism
    NIES204_10430
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    NIES204_10430
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     NIES204_10430
    1.3.5.4  fumarate reductase (quinol)
     NIES204_10430
SSDB
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_9 Fer4_10 Fer4_7 Fer4_18 Fer4_16 Fer2 Fer4_15
Other DBs
NCBI-ProteinID: BBD53763
UniProt: A0A2Z6CCR7
LinkDB
Position
complement(1278653..1279666)
AA seq 337 aa
MRVKFNIVRQNPNTSREVQSYLLDVEPGNTILDCLNRIKWEQDGTLAFRKNCRNTICGSC
SMGINGRSALACKENIGSEVARLQKIAEANSSQTPSNDIPEMTIAPMGNFPVIKDLVVDM
SRFWDNLQTVEPYISTAGRAIPEREFLQTPEERSQLDQMGNCILCGACYSECNAVEVNPD
FVGPHALAKAQRMVADSRDAKTEQRLEQYSQGTNGVWGCTRCFNCNSVCPMEVAPLDQIT
KIKHEILERKDASASRPIRHRKVLVELVKQGGWVDERKFAVMVVGNYFRDLKGLLSLGPV
GMRVIMRGKFPLTFEPSEGTETVRSLIQSIQDLEKQP
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgagagttaagtttaatattgtccgccaaaatcctaatacctcaagggaggtgcaaagt
tatctcctcgatgtcgaacccggaaatactattttagactgtcttaaccgaattaaatgg
gaacaggacggaactttagcctttagaaaaaactgtcgcaataccatctgtggtagttgt
tccatgggaattaatggccgttctgcgttagcctgtaaggaaaatattggcagtgaagtt
gcccgtttacaaaaaattgccgaggcgaactccagtcagactccttcaaacgatatccca
gaaatgactattgctccgatggggaatttccccgtgatcaaagacttggtggtggacatg
agccgtttttgggataacttgcaaaccgttgaaccctatattagtaccgcaggtcgggct
attcctgaacgggaatttctgcaaaccccagaagaacgatcccaacttgatcaaatgggc
aactgtatcctctgtggggcttgttattccgaatgtaatgccgtcgaagttaaccccgat
tttgtcgggccccacgccttagctaaagctcaacggatggtagccgactccagggatgcc
aaaactgaacaacgtttagaacaatatagccaaggaaccaacggggtttggggctgtacc
cgttgctttaactgtaactctgtttgtccgatggaggtcgcccccctagatcagattact
aaaattaaacatgaaattctcgaacgcaaagatgccagcgccagtcgtcccatccgccac
cggaaggttttagtggaattggtaaaacagggaggttgggtagatgaacgcaaatttgct
gtaatggtagtggggaattatttccgcgatctcaaggggttactcagcttagggcccgtg
ggaatgcgggtgatcatgcggggtaaatttcccttgacctttgaaccctctgaaggcaca
gaaaccgtgcgatcgctcattcaatctattcaagacttagaaaaacaaccatga

DBGET integrated database retrieval system