KEGG   Planktothrix agardhii: NIES204_06360
Entry
NIES204_06360     CDS       T05658                                 

Definition
(GenBank) phosphoribulokinase
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_06360
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     NIES204_06360
SSDB
Motif
Pfam: PRK Zeta_toxin AAA_33 TsaE ABC_tran MobB AAA_23 AAA_5 NTPase_1 AAA_18
Other DBs
NCBI-ProteinID: BBD53369
UniProt: A0A2Z6CA53
LinkDB
Position
complement(774755..775687)
AA seq 310 aa
MTHRPIILGIVGDSAAGKTTLTRGIAQVLGEENVTVICTDDYHRYDRKQRAEMDITALNP
DCNYLDIMQQHLTLLRTGQPILKPIYNHHHGTFDAPEYIKPNRFVIVEGLLGYSTRGVRD
NYDVKVYLAPPESLRSKWKIKRDTMKRGYSEEDVVLALKQREPDSEAFIRPQRKSADVVV
TFYHPDGDENGTNLNVRLVLRPTIPHPDFSEILQQQNGHHIEAVRLGLDRDMGKPVDVLE
IDSHATLEQVNALEMILCNELPSLKNFCSSGGNQNLGILTGTTGEILQSYPLALTQLLIA
YHMIKATKLI
NT seq 933 nt   +upstreamnt  +downstreamnt
atgacacatcgaccgattattttaggaattgttggagacagtgccgccggaaaaacaacc
ttaacaagaggaattgctcaagtcttaggtgaagaaaatgtaacggtaatttgtaccgac
gattatcatcgttatgatcgtaaacaacgtgccgaaatggatatcactgccttaaatcca
gattgtaattatctggatattatgcaacaacatctaactttattaagaacgggacaaccc
attttaaaaccgatttataatcatcatcatggaacttttgatgcaccggaatatattaaa
cccaatcggtttgtaattgtcgaaggtttactgggttattctactcgtggagttcgggat
aattatgatgttaaagtgtatttagctcctcctgaatccctacgcagtaaatggaaaatt
aaacgagatacaatgaaacggggttacagcgaagaagatgtagttcttgccttaaaacaa
agggaacctgactcagaagcatttattcgtcctcaaagaaaatcagccgatgtggttgtt
accttttatcatccagatggtgatgaaaatggaactaatttgaacgttcgtttagttttg
cgtccgaccattccccacccagatttcagtgaaattttacagcaacaaaatggtcatcat
attgaagcggtacgtctaggattagatcgagatatgggtaaaccagtagatgtcctagaa
attgatagccacgccaccttagagcaggtgaacgcattagaaatgattctttgtaatgaa
ttaccgagtttaaaaaatttttgtagttctggagggaatcaaaatttgggaattttaaca
ggtacaaccggagaaatactacaaagctatcctctagctttaactcaactgttaattgcc
tatcacatgattaaagcaactaaattaatttag

KEGG   Planktothrix agardhii: NIES204_23810
Entry
NIES204_23810     CDS       T05658                                 

Gene name
prk
Definition
(GenBank) phosphoribulokinase
  KO
K00855  phosphoribulokinase [EC:2.7.1.19]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_23810 (prk)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.19  phosphoribulokinase
     NIES204_23810 (prk)
SSDB
Motif
Pfam: PRK AAA_18 ABC_tran Zeta_toxin AAA_16 NACHT AAA_5 Rad17 RNA_helicase Ras AAA_22 MMR_HSR1 AAA_33
Other DBs
NCBI-ProteinID: BBD55081
UniProt: A0A2Z6CEU1
LinkDB
Position
complement(2706363..2707367)
AA seq 334 aa
MGNKPDRVVLIGVAGDSGCGKSTFLRRITDIFGKDFVTVICLDDYHCLDRKQRKETGITA
LDPRANNFDLMYQQVNALKNGISIDKPIYNHETGELDPPERIEPNHIIVIEGLHPLYDER
VRSLLDFSVYLDISDEVKISWKIQRDMAERGHRYEDVLAAINARRPDFEAYIDPQKQYAD
VVVQILPTNLIAEDKEHKVLRVRLVQKEGVEGLEPSYLFDQGSTIYWIPCGRKLTCSYPG
LKMYYGPDNYYGNEVSILEVDGQFDNLDEMIYVEGHLSNLSTKYYGEMTHLLRERQEYPG
SNNGSGLFQVLVGLKMRATYERLVSANEKVAAAV
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggaaataagccggatcgcgtggttttaattggtgttgctggagattctgggtgcgga
aaatcaacatttttacgtcggataacagacatctttggaaaagattttgtaacggttatc
tgtttagatgattaccattgtttagatcgtaagcaacgcaaagaaactggaattactgct
cttgatcctagagctaataatttcgatttaatgtatcagcaagttaacgctcttaaaaac
ggtatatccattgataaacccatttataatcatgaaactggcgagttagatccccccgaa
cgaatcgagcccaatcatattattgtgattgaaggattgcacccgttatatgacgaaaga
gtgcgatcgctgcttgattttagtgtttatctggatatcagcgacgaagttaaaatttcg
tggaaaattcagcgcgatatggcggaacggggacatcgttatgaagatgttttggcggca
attaatgctcgtcgtcctgattttgaagcctatattgacccccaaaagcaatatgcggat
gtggtggttcaaattctacccactaacttgattgctgaagacaaggaacacaaagttctg
cgggtgcgtttggtacagaaagaaggtgtggaaggactcgaaccctcctacttatttgat
caaggatcaacgatttactggataccttgcggacgtaaactcacctgttcctatccgggt
ctaaaaatgtattacggccccgataattactacggaaatgaagtgtctatcctcgaagtt
gatggtcaattcgataacctcgatgaaatgatctacgtcgaaggacacttaagcaacctg
tctacgaaatattatggagagatgacccacctcctccgcgaacgccaagagtatcccggt
tccaataatggtagcggattattccaggtgttagttggtctgaaaatgcgggcgacctac
gagcgcttagttagtgctaacgaaaaagttgccgctgcggtctaa

DBGET integrated database retrieval system