KEGG   Planktothrix agardhii: NIES204_08160
Entry
NIES204_08160     CDS       T05658                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00230  Purine metabolism
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
pagh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pagh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_08160
   00620 Pyruvate metabolism
    NIES204_08160
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIES204_08160
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pagh04131]
    NIES204_08160
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_08160
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     NIES204_08160
Membrane trafficking [BR:pagh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NIES204_08160
Exosome [BR:pagh04147]
 Exosomal proteins
  Proteins found in most exosomes
   NIES204_08160
SSDB
Motif
Pfam: PK PK_C HpcH_HpaI IF2_N
Other DBs
NCBI-ProteinID: BBD53542
UniProt: A0A2Z6CB42
LinkDB
Position
complement(965103..966530)
AA seq 475 aa
MIKPLHHRTKIVATIGPASKSPEIIRQMVNAGMNVARLNFSHGSYEDHAEMVGLLRQVSK
ECNAPITLLQDLQGPKIRIGKLPSEEIELVQGELLTLVPLDNFDNQPNTAPIDYSYLAEE
ADLGAQVLLDDGLLELKIEEIQGNAVICRVIEGGILKSRKGVNLPSLILRLPSLTEKDQQ
DLDFGISQGVDWVSLSFVRRAEDVQALKALLIEKGASDIPVMAKIEKPQAIANLESIINE
CDGLMVARGDLGVEMSPEKVPLLQKQIIRMCNQKGIPVITATQMLDSMIHSARPTRAEAS
DVANAIIDGTDAVMLSGESAVGKFPVKAVQMLSRIASDVEPEIEFKNYPPVMSDETHALS
EALNTIDKVLNLHCIVAYTSTGYTAILAAGERPKVPVIALTPNLKVYHRLNLVWGVKPIL
LEHQVDSFEGLIDLAQTKLLEGLLAQIGDKILIIGGVPTKKAKGTNFLKIHTIAD
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgatcaaacctttacaccacagaacaaaaattgttgcgactattggccctgctagtaaa
tccccagagatcatccgtcaaatggtgaatgcgggaatgaatgtcgcccgattaaatttt
tcccatggtagttatgaagatcatgcggaaatggtaggattgttgcggcaagtttccaaa
gaatgcaatgccccgattactttattacaagatttacaaggcccaaaaattagaattggt
aagctaccatcggaagaaatagaattagttcaaggagaattattaaccttagttccctta
gataattttgacaatcaaccgaatacagcccccattgattattcctatttagcagaagaa
gccgacctcggagcgcaagttttactagatgatggattattagaattaaaaatagaagaa
attcagggaaatgccgttatatgtagggtgattgaagggggaatcctaaaaagtcgaaaa
ggagttaatttaccgagtctaattttgcgtcttccctccttaacggaaaaagatcaacag
gatttagattttggaatttcccagggtgtagactgggtttctttgagttttgttcgccgt
gcggaggatgttcaagccttaaaagcattattaattgaaaagggcgcatcggatattccg
gtcatggcaaaaattgaaaaacctcaagcgatcgccaatttagaatctattattaatgaa
tgtgatggtttaatggtagcacggggggatttaggggtagaaatgagtcctgagaaagtg
ccattattgcaaaaacaaatcattcggatgtgtaatcaaaaagggattccagtgattact
gctacccaaatgttagatagtatgattcacagtgcacgtcccacccgtgcagaagcaagt
gatgttgcgaatgcaatcattgatggtacggatgcggtcatgttatctggagaatctgct
gttggtaaattcccagtgaaagcagtacaaatgttatccagaattgccagtgatgtcgaa
ccggaaatcgagtttaaaaattatcctccggtgatgtccgatgaaactcatgctttaagt
gaagctttaaatacgattgataaagtcttgaatttgcattgtattgttgcttataccagc
acaggatatacggctattttagcagcaggagaacgacctaaagttcccgttatcgcccta
actcccaatctaaaggtttatcaccgtttaaacttagtttggggcgttaaaccgatttta
ttagaacatcaagtggactcttttgaaggattaattgatctcgcccaaactaaattatta
gaagggctattagctcaaattggggataaaatattaattattggaggtgttccaaccaag
aaagcaaaaggcacaaatttcttgaagattcacacaattgccgattaa

KEGG   Planktothrix agardhii: NIES204_12220
Entry
NIES204_12220     CDS       T05658                                 

Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00230  Purine metabolism
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
pagh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
pagh_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_12220
   00620 Pyruvate metabolism
    NIES204_12220
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NIES204_12220
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pagh04131]
    NIES204_12220
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_12220
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     NIES204_12220
Membrane trafficking [BR:pagh04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    NIES204_12220
Exosome [BR:pagh04147]
 Exosomal proteins
  Proteins found in most exosomes
   NIES204_12220
SSDB
Motif
Pfam: PK PK_C PEP-utilizers PucR HpcH_HpaI
Other DBs
NCBI-ProteinID: BBD53938
UniProt: A0A2Z6CBX6
LinkDB
Position
1478953..1480734
AA seq 593 aa
MQPQNLLHRTKIVATIGPATQKPEVLRALIEAGATTLRLNFSHNTHEDHQRSIRMIRQTA
FELNQPVGILQDLQGPKIRLGKFETGSIILNRDDQFILTSEDVVGTQEMSSVTYKPLADE
VPNGAVILLDDGKVEMVVEKVEPSKGRLYCRVVVGGTLSNSKGVNFPGVYLSIKAMTEKD
RKDLMFGLDQGVDWVALSFVRNPQDVLEIKELIASAGKDVPVIAKIEKHEAIEQMEEILA
LCNGVMVARGDLGVELPAEDVPILQKRLIITANRMGIPVITATQMLDSMVNNPRPTRAEI
SDVANAILDGTDAVMLSNETAVGNYPVEAVATMARIAVRIEQEGATRNVSKVEDTGRSIP
NAISQAVAQISHQLNAAAIMTLTKTGSTARNVSKFRPQTPILAITPHVEVARQLSLVWGV
KPLLVLDLPSADQTFQAAVNVAREKNLLADGDLVVTTAGTLQGVAGSTDLIKVEVVTAAL
GKGTAVGQGCVTGRARVARSAGELADFNAGEILVTVQTSADFVDVMRKAGGVVTEADSLT
SHAAVIALRLGVPVIVGVNNATRLIRDGVILTLDMERGIVYSGANSGSGTENI
NT seq 1782 nt   +upstreamnt  +downstreamnt
atgcaaccgcaaaatctactgcatcgaactaaaatagtcgctacaatcggccctgctacc
cagaagcctgaagttctccgcgcattgattgaagcgggtgcaacgactctgcgcttaaat
ttttcccataatacccatgaggatcatcaacgcagtattcggatgattcgacaaaccgcc
tttgaactgaatcaacccgtggggattttacaagatctccaaggcccaaaaatcagatta
ggcaaatttgagacgggttcgattattttgaaccgggatgatcagtttattctcaccagt
gaagacgtggtgggaacccaagaaatgtcctctgttacctataaacctttagccgatgaa
gtcccaaatggggcggtgattctcctcgatgatggcaaggtggaaatggtcgtagagaaa
gtcgaaccatcaaaaggacgcttatattgtcgtgtcgttgtaggcgggactctttctaat
agtaaaggggtgaattttcctggggtttatctctccattaaagccatgaccgaaaaagac
cgcaaggacttaatgtttggtttagatcaaggagtggactgggtagctttaagtttcgtc
agaaatccccaggacgtcttagaaattaaagaattaattgcgagtgcggggaaagatgtt
cccgtgattgccaaaattgaaaaacacgaagccattgaacaaatggaagaaattctggct
ttgtgtaatggggtgatggtggccagaggcgatttaggggtggaacttcccgccgaggat
gtgccgattttacaaaaacggttaattatcaccgctaaccgcatgggaattccggtaatt
accgccactcagatgttagatagcatggtgaataatccccgacccacccgggcggaaatt
tccgatgtggcgaatgcgattttagatggtaccgatgcggtgatgctctccaatgaaacc
gccgtgggtaactatccggtggaagcggtggcgaccatggcccggattgcggtgcggatt
gagcaggagggggcgacccgcaatgtttctaaagtagaagataccggacgttctattcct
aatgccattagtcaggcggtggcacaaatttctcaccagttgaacgcggcggcgattatg
accttaactaaaactgggtctacggctcggaatgtgtcaaagttccggccccaaaccccg
attttagcgattaccccccacgtggaagtagcccgacagttgagtttagtttggggggtg
aaaccgttattggttttagatttaccttcggctgaccaaacatttcaagctgctgtgaat
gtggctagggaaaaaaatctcctggccgatggggatttggttgttaccacggcgggaact
ctacagggggttgccggatctacggatttgattaaggtagaagtggtgacggctgctttg
gggaagggaacggccgtgggtcagggctgtgtgactggacgggcgcgggttgcccgtagc
gccggagagttggccgattttaatgctggggaaattttggttacggttcaaaccagtgcc
gattttgtcgatgtgatgcgaaaggcggggggtgtggtcaccgaagccgatagtttgacc
agtcacgcggcggtaattgctttacggttgggagttcctgtgattgttggggtaaataat
gccacccgcttaattcgagatggggtgattctgaccttagatatggagcgcgggattgta
tattcgggagccaacagtggttcggggactgaaaatatctga

DBGET integrated database retrieval system