KEGG   Planktothrix agardhii: NIES204_08680
Entry
NIES204_08680     CDS       T05658                                 

Gene name
fumC
Definition
(GenBank) fumarate hydratase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_08680 (fumC)
   00620 Pyruvate metabolism
    NIES204_08680 (fumC)
Enzymes [BR:pagh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     NIES204_08680 (fumC)
SSDB
Motif
Pfam: Lyase_1 FumaraseC_C
Other DBs
NCBI-ProteinID: BBD53594
UniProt: A0A2Z6CBQ3
LinkDB
Position
complement(1024391..1025794)
AA seq 467 aa
MTTEQPTRKERDSMGEIEVKSDRYWGAQTQRSIYYFNIGNDLMPKEVITAFGILKKAAAI
TNEELGKLPADKAQLIVQAADEVIDGKLDDHFPLKVWMTGSGTQSNMNINEVIANRGIEI
SGGILGSKTPIHPNDHVNMSQSSNDTFPTAMHIAAAIAVTQRLIPSVKKMRDELQKKVDE
FADIVKIGRTHLQDAVPLTLGQEFSGYVAQLDADLKRLELILPDLYELAIGGTAVGTGLN
TPKGFAEKVSNHISQITGLPFISAPNKFAAMAAHDGLVMASGALKTLACSLMKIANDIRF
LGSGPRCGLGELILPENEPGSSIMPGKVNPTQCEAITMVAAQVMGYDTAITIAGSHGHFE
LNVFKPMIIFNFIQSVAILSDSCHNFTDFLLAGLKVNRNKINSYVEQSLMLVTALAPKIG
YDHAAQVAHIALEKNLTLKEVCLELGYISSEEFDQIVNPYKMAYPDV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacaacagaacaaccgacccggaaagaacgcgatagtatgggagaaattgaggttaaa
agcgatcgctattggggcgctcaaactcaacgttctatctattattttaatataggcaat
gatttaatgcccaaggaagtgattaccgcctttgggattctgaaaaaagccgcggctatc
accaatgaagaattaggaaaactccccgcagacaaagctcaattaatcgttcaagccgcc
gatgaagtgattgatggcaaactcgatgatcactttcctttaaaggtttggatgaccgga
agtggaacccaatctaatatgaatattaatgaagttattgctaatcgagggattgaaatt
tccggcggaatattaggcagtaaaaccccaattcatcccaatgatcatgttaatatgtcc
caatcttctaatgatacctttcctaccgccatgcacattgcggcggcgatcgccgtgacc
caaaggttaattcccagcgtcaaaaaaatgcgagatgagttacaaaaaaaagtcgatgaa
tttgccgatattgttaaaattggcagaacccatttacaagatgctgttcccttaacttta
ggtcaagaattttccggttatgttgctcaactcgatgcagatttaaagcgtcttgaactt
attttacccgatttatatgaattagccattggtggaaccgccgttggaacgggattaaat
accccgaaaggatttgcagaaaaagtctctaatcatattagtcaaataaccggattaccc
tttatttctgctccgaataaatttgcagccatggccgcccatgatggtctagttatggct
agtggggcattaaaaaccctagcctgttccttgatgaaaattgccaacgatattcggttt
ttaggcagtggcccccgttgtggtttaggggaattaatattacctgaaaatgaacctggt
tcatcaattatgccggggaaagttaacccaacccaatgcgaagcgatcaccatggtagcc
gcccaggtaatgggttatgatactgctattactattgcaggttcccatgggcattttgag
ttaaatgtgttcaaaccgatgatcatttttaacttcattcaatcggtggctattttatcc
gatagttgtcataattttacggatttcttattagctggattaaaagttaatcgaaataaa
attaacagctatgttgaacaatctttaatgttagtgacagctttagctcctaaaattggc
tatgatcatgctgcccaagttgcccatattgccctggaaaaaaatctgactttaaaggaa
gtttgtttggaattaggatatatttccagtgaagaatttgaccagattgtcaatccctat
aaaatggcttatcctgatgtctaa

DBGET integrated database retrieval system