KEGG   Planktothrix agardhii: NIES204_09060
Entry
NIES204_09060     CDS       T05658                                 

Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00290  Valine, leucine and isoleucine biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_09060
   00290 Valine, leucine and isoleucine biosynthesis
    NIES204_09060
Enzymes [BR:pagh01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     NIES204_09060
SSDB
Motif
Pfam: PALP Thr_dehydrat_C HU-HIG
Other DBs
NCBI-ProteinID: BBD53631
UniProt: A0A2Z6CAW0
LinkDB
Position
complement(1070409..1071920)
AA seq 503 aa
MLCDYLVQILTARVYDVAQETPLESAPNLSARLNNKLLLKREDMQSVFSFKLRGAYNKMA
HLSPNLLKKGVIAASAGNHAQGVALGASKLGTKAIIVMPVTTPQVKVNAVKARGGEVILY
GDTFDESCAYARQLETEKGLTFIHPFDDPYVIAGQGTIGMEILRQYQQPIHAIFVAIGGG
GLISGIAAYIKRLRPEIKIIGVEPVDADAMSQSLKAGHRVKLSQVGLFADGVAVREVGEE
TFRLCQEYVDEIILVDTDDTCAAIKDVFEDTRSILEPAGALAIAGAKAYVEREKIQGETL
IAIACGANMNFDRLRFVAERAEFGERREAIFAVTIPEEPGSLRKFCECIGKRNLTEFNYR
IADEKEAHIFVGMQIKNREDAAQIIEYFQENGFKTIDLTDDELTKLHLRHMVGGRSTLAH
HELLYRFEFPERPGALMKFVCSMSPNWNISLFHYRNNGSDYGRIVAGIQVPPEEMGEWQA
FLDTLGYRYWDENKNPAYKLFLS
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgctttgcgactacctagtacaaattctcaccgcccgtgtttatgatgttgcccaagaa
acacccctagaatccgctcccaacctctccgcccgcttgaataataaactactcttgaaa
cgagaagatatgcagtctgttttctcctttaaattgcggggagcttataataaaatggct
catctttcccccaatttattaaagaaaggagtgatagcagcatcggcgggaaatcatgcc
caaggtgtggctttaggggcatctaaattaggcacaaaagccattattgttatgcctgta
accaccccccaagttaaagttaatgccgtcaaagcaagaggcggtgaagtaatattatat
ggagatacttttgatgaatcttgcgcctatgctcgtcaactagaaactgagaaaggatta
acctttattcacccctttgatgacccctatgttattgctggacagggtacaattgggatg
gaaattttacgacaatatcaacaaccaattcatgctatttttgttgctattggtgggggg
ggattaatctcaggaattgccgcttatattaaaagattacgcccagaaattaaaattatt
ggagttgaacccgtggatgcggatgcgatgtcacaatctttaaaagccggacatcgggtt
aaattatcacaggtgggattatttgctgatggggtagcggtgcgagaagtgggggaagaa
accttccgtttatgtcaagaatatgtggatgaaattatattagttgatacggatgatact
tgtgccgccattaaagatgtttttgaggatactcgctcaattttagagcctgcgggagcc
ttagcaatagcaggagctaaagcttatgttgaaagagaaaaaattcaaggagaaacacta
attgctattgcttgtggggcaaatatgaattttgaccgcctgcgatttgtagcagaaaga
gccgaatttggagaacgccgagaggcaatttttgcggttactattcccgaagaacctggt
agtttgcggaagttttgtgaatgtattggtaaacgcaatttaacggaatttaactatcgc
attgctgatgaaaaagaagctcatatttttgtcggaatgcagattaaaaatcgggaagat
gcggcacaaataatcgaatattttcaggaaaatggatttaaaactattgatttaaccgat
gatgaactaactaaattacatctgcgccacatggtcgggggacggtctactttagcccat
catgaattactctatcgctttgaatttcccgaacgtccgggggcgttaatgaagtttgtt
tgttccatgagtcctaactggaatattagtttatttcactatcggaataatggctcagat
tatggcagaattgtggcaggaatacaggttcctcccgaagaaatgggagaatggcaagct
tttttagatactttaggttatcgctattgggatgagaataaaaacccagcctataaacta
tttttatcctaa

DBGET integrated database retrieval system