KEGG   Planktothrix agardhii: NIES204_10800
Entry
NIES204_10800     CDS       T05658                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00051  Fructose and mannose metabolism
pagh00680  Methane metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_10800
   00030 Pentose phosphate pathway
    NIES204_10800
   00051 Fructose and mannose metabolism
    NIES204_10800
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_10800
   00680 Methane metabolism
    NIES204_10800
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     NIES204_10800
SSDB
Motif
Pfam: F_bP_aldolase OST_P2 MraZ
Other DBs
NCBI-ProteinID: BBD53798
UniProt: A0A2Z6CBK9
LinkDB
Position
1323012..1324091
AA seq 359 aa
MALVPMRLLLDHAAENDYGLPAYNVNNMEQIQAIMQAAEETNSPVILQASRGARQYAGES
FLRHLILAAVETYPHIPIAMHQDHGNSPATCYSAMRHGFTSVMMDGSLKADGKTPANLEY
NVAVTLEVVKVAHSIGVSVEGELGCLGSLETMQGDKEDGHGAEGKLTMEQLLTDPDEAVE
FVERTQVDALAIAIGTSHGAYKFTRKPTGEILAISRIEEIHRRLPNTHLVMHGSSSVPEN
LLEIINKYGGQIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAFREAAFSDPSNFD
PRHFLKPSIKYMKQVCADRYNQFGSAGNADKIKVQTLDEFAAKYAKGELSATTKTAVAV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcgctcgtacccatgcggcttttgctagatcatgcggctgaaaacgattatggactt
cctgcatacaatgtgaataacatggagcagatccaagccattatgcaggctgcggaagaa
actaatagccctgtgattttgcaagcttctcgcggcgctcgtcaatatgcgggcgaaagc
ttcctacgccacctgattttagcggcggtggaaacctatccccacatccccattgccatg
caccaagatcacggcaactctcccgccacctgctattcggcgatgcgtcatggctttact
agcgtgatgatggatggttccctcaaagccgatggtaaaacccccgccaaccttgaatat
aacgtggccgtcaccttggaagtggtgaaagtggctcactccattggtgttagcgttgaa
ggcgaactaggttgtttaggttccctggaaaccatgcaaggtgacaaagaagatggtcac
ggtgcagaagggaaattaaccatggaacagttgttaactgaccctgacgaagctgttgag
ttcgtggaacgtacccaagtagacgctttagcgatcgccattggcaccagtcacggagct
tacaaattcacccggaaaccgactggtgaaattttggcaattagtcgcattgaagaaatt
caccgtcgtttaccgaatactcacttagtgatgcacggttcttcttctgttcctgaaaat
ttgttagaaatcatcaacaaatacggtggtcaaatccctgaaacctatggggttcctgtg
gaagaaatccaaaaaggaattaagagcggtgttcggaaagttaatattgatactgacaac
cgtttagcgattaccgcagccttccgagaagcggctttctcagatccttctaactttgat
ccccgtcacttcctgaaaccttctatcaaatatatgaagcaagtttgtgcggatcgttat
aatcaattcggttctgcgggtaatgcagataagatcaaagttcaaactttagatgagttt
gcagctaagtacgctaaaggtgaattgagtgctactactaaaacggctgtggcagtttaa

DBGET integrated database retrieval system