KEGG   Planktothrix agardhii: NIES204_11550
Entry
NIES204_11550     CDS       T05658                                 

Gene name
eno
Definition
(GenBank) phosphopyruvate hydratase
  KO
K01689  enolase [EC:4.2.1.11]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
pagh03018  RNA degradation
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_11550 (eno)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_11550 (eno)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    NIES204_11550 (eno)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pagh03019]
    NIES204_11550 (eno)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_11550 (eno)
Enzymes [BR:pagh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.11  phosphopyruvate hydratase
     NIES204_11550 (eno)
Messenger RNA biogenesis [BR:pagh03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     NIES204_11550 (eno)
Exosome [BR:pagh04147]
 Exosomal proteins
  Proteins found in most exosomes
   NIES204_11550 (eno)
SSDB
Motif
Pfam: Enolase_C Enolase_N MR_MLE_C MAAL_C
Other DBs
NCBI-ProteinID: BBD53871
UniProt: A0A2Z6CBK1
LinkDB
Position
1399440..1400729
AA seq 429 aa
MSDSGILTIIAREILDSRGRPTLEAEVYLDNGAYGHAQVPSGASTGSFEAHELRDGDKSR
YGGKGVLTAVKNVNEVIAPALNGVSALEQTVIDQIMLDLDGTPNKSNLGANAILGVSLAV
AKAAAETLGLPLYRYLGGPIANLLPVPLMNVINGGSHAANNVDIQEFMIVPIGAPTFKEA
LRCGAEVFASLSDVLKGKGLLGGVGDEGGFAPNLGSNQEALDILIQAIEIAGYKPGEQVA
LALDVAASEFYKDGIYTYDGQPNSGEQLTEYLSKLTSQYPIISIEDGLHEDDWVHWKSLT
EKLGSKVQLVGDDLFVTNPTRLKRGLEEKIANSILVKLNQIGSLSETLETVDLATRNGYT
SIISHRSGETEDTTIADLAVATRAGQIKTGSLCRSERVAKYNRLLRIEDELGAQAVYAGA
VGLGPRFSK
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtcagacagtggaattcttactattattgcccgtgaaatcctcgactctcgcggacgc
ccaaccctcgaagccgaagtctacctcgataacggagcttatggacacgctcaagttccc
agtggagcctccaccggaagctttgaagcccatgaactccgagatggagataaaagccgt
tatgggggtaaaggagttctaacggcggttaaaaacgtcaacgaagtcatcgccccagcc
ctgaacggagttagcgccctagaacaaaccgtcatcgaccaaatcatgctcgacctcgat
ggcactcccaataaaagcaacctgggagctaatgccatcctaggcgtctccctagccgtc
gctaaagcggccgccgaaaccctgggtttacccctctatcgttacttaggcggccccatt
gccaacctcctccccgtccccttgatgaacgtgattaacggaggttcccacgccgcgaat
aacgtggatattcaggaatttatgatcgttcccattggggctcccaccttcaaagaagcc
ctgcgttgtggtgcggaagtgtttgcgtccctgagtgacgtcttgaaaggtaaaggactc
ctgggtggtgtgggagatgaaggcggttttgctcctaatttgggttctaaccaagaagcc
ttagatattctcatccaagctattgaaatcgcgggttataaacccggtgaacaggtcgca
ctggctctggatgtggccgcgagtgaattctataaagatggtatctatacctacgacggt
caaccgaatagtggggagcaactgactgaatacctgagtaaattaaccagtcagtacccg
attatttccatcgaagacggtctccacgaggatgactgggttcactggaaatccctaacg
gaaaaactcggtagtaaagtgcaactggtgggcgatgacctatttgtgactaacccaacc
cgtttaaaaagaggtcttgaggagaaaatagcgaattctattttggtgaaactcaaccaa
attggttctctgtcggaaaccttagaaaccgttgacctagcaacccgcaatggttatact
tccataattagtcaccgttccggggaaactgaagataccacgattgcagacctggccgtt
gctacccgagccggacaaattaaaacgggttctctgtgtcggagtgaacgggttgctaaa
tataaccgtttattacggattgaagacgaactcggtgcccaagcggtttatgctggagcc
gttggcctaggcccccgtttctcgaaataa

DBGET integrated database retrieval system