KEGG   Planktothrix agardhii: NIES204_11900
Entry
NIES204_11900     CDS       T05658                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K22305  phosphoserine phosphatase [EC:3.1.3.3]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_11900
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_11900
Enzymes [BR:pagh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.3  phosphoserine phosphatase
     NIES204_11900
SSDB
Motif
Pfam: His_Phos_1
Other DBs
NCBI-ProteinID: BBD53906
UniProt: A0A2Z6CBQ5
LinkDB
Position
1447674..1449032
AA seq 452 aa
MTTRVILVRHGQSTYNAQSRIQGRLDASVLTEKGSVAAQKVGDALNGLKFDALYCSPLQR
AKQTAQIIVTYLSDPPKVEPSDLLMEIDLPLWAGMERQAVMAQFPQEYQTWHDSPHEFSM
LVSTPEGEKQHFPVLALFEQAKQFWREILARHQNQTVLLVAHNGINRCLIATALGIQPQF
YQSVQQSNCGISILNFTNIIPGELPKPADVQLESMNLTTHVCHKLPSVRPGHQGPRLLLV
RHGETEWNRMGQFQGQIDVPLNDNGREQARKAAEFLKEIKIDFAVTSPMARPKETAEIIL
QNHPGIELQLEPEFCEISHGLWEGKFEAEIEQFYPGLLGEWKIAPQTVQMPEGENLQQVW
QRSLIAWKQIVETYNHQNVTILVVAHDAINKALLCQLFNLPPDHFWNFKQGNGAVTVIDY
PQGIEGLPVLQADNITSHLSGSILDKTAAGAL
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgacgacccgtgtaattcttgtccgtcatggtcaaagtacctataatgcccaaagtcga
attcaaggtcgcttggatgcctctgttttaacagagaaaggttctgtggccgctcagaaa
gtcggtgatgccttgaatggtttaaagtttgacgctctctattgcagtcccctgcaacgg
gcgaaacaaacagcccaaatcatcgtcacctatctgtctgacccccctaaagtagagccc
agcgacctgttaatggaaattgatcttcccctgtgggcggggatggaacgtcaagcggtg
atggcacagtttccccaagagtatcagacctggcacgactcgccccatgagttttcgatg
ctggtttcaactcctgaaggagaaaaacaacattttcccgtattagcattatttgaacag
gcgaaacaattttggcgggaaattttagcccgtcatcaaaatcaaacggttttattagta
gctcataatggaattaatcgttgtttaattgcgacggctttaggaattcaacctcaattt
tatcaaagtgtacaacagtctaactgtgggattagtattttgaattttactaatattatc
cccggagaattaccgaaacctgcggatgtacagttagagtcgatgaacttaacaacccac
gtttgtcataaattaccttctgtgcgtccgggtcatcaagggccgcgattattattagtt
agacatggggaaacggaatggaaccgcatgggtcaattccagggacaaattgatgttcct
ttgaatgataatggtcgagaacaagctcgcaaagcggcggaatttctcaaagaaattaaa
attgattttgcggtaacgagtcccatggcgcgtcccaaggaaaccgcagaaattatatta
caaaatcatccggggatagagttacaattagaaccggaattttgtgaaattagtcatggt
ttatgggaaggtaaatttgaggcggaaatcgaacaattttaccccggattattaggggaa
tggaaaatagcaccgcaaacggttcaaatgcctgaaggtgagaatttacaacaggtttgg
caacgttctttaattgcgtggaagcagattgttgaaacctataatcaccaaaatgtaact
atattagtggttgcccatgatgccattaataaagcccttttgtgtcaattatttaatctg
cctccggatcatttttggaactttaaacaaggtaatggggcggtgacagtaattgattat
ccccaaggaattgagggtttacctgtgttacaagctgataatattactagccatttatcg
ggtagtattctcgataaaacggcggcgggagcgttatag

DBGET integrated database retrieval system