KEGG   Planktothrix agardhii: NIES204_12790
Entry
NIES204_12790     CDS       T05658                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00270  Cysteine and methionine metabolism
pagh00620  Pyruvate metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00680  Methane metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_12790
   00620 Pyruvate metabolism
    NIES204_12790
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_12790
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_12790
   00680 Methane metabolism
    NIES204_12790
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NIES204_12790
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     NIES204_12790
SSDB
Motif
Pfam: Ldh_1_N Ldh_1_C Shikimate_DH F420_oxidored Glyco_hydro_4 UDPG_MGDP_dh_N bVLRF1 TrkA_N 3HCDH_N
Other DBs
NCBI-ProteinID: BBD53995
UniProt: A0A2Z6CC81
LinkDB
Position
complement(1541252..1542220)
AA seq 322 aa
MLSIPFFPPSCHSTRVSIIGAGKVGSTLAQRIIEQNIANVVLLDILEGVPQGIALDLMQA
GSVEGHDRQITGTNDYRDTANSDIIVITAGKPRIPGMKRDNLISINAKIVVDAAQKSIQY
SPDAVFIIVTNPLDIMTYIAWQATKIEPHRVMGMAGVLDSSRFQTFIAMELGMSMANIHA
TVLGSHGDLMVPLPRYTTVNGIPITELIDQKTINKIVERTRQGGGEIVQLLKTGGAYFAP
ASSIRIMVESILRQQLRLLPACSYLQGEYGLNDIFLGVPAWLGCRGVERILELDLTESEH
QALMECSTSVRAGINQALEFLG
NT seq 969 nt   +upstreamnt  +downstreamnt
atgttatcgattccattttttcctccttcttgtcattcaactcgggtttctattattggg
gcgggaaaagtcggaagtaccctcgcccagcgtattattgaacaaaatattgctaatgtt
gttttattggatattttagaaggagtgcctcaaggaattgctttagatttaatgcaagcg
ggttcggtggaaggtcatgatcgacaaataactggcacaaatgattatcgcgatactgct
aattcagatattattgttataactgccggaaagcctcgaattcctgggatgaagcgggat
aatttaattagtattaatgccaaaattgttgtcgatgcggctcaaaaatcaattcaatat
tccccggatgcagtatttattattgtgactaatcccttagatattatgacttatattgct
tggcaggcaacaaagattgaaccccatcgcgtgatgggcatggctggggttttagattca
tcgagatttcaaacgtttatcgctatggaattaggaatgtctatggcgaatattcatgcc
accgtattaggaagtcatggggatttaatggttcctttaccccgttatacaactgttaat
gggattccaattacagaattaattgatcaaaaaaccattaataaaattgtcgaacgtacc
cgtcagggcgggggagaaattgtacaattattaaaaacaggaggagcttattttgccccg
gcatcttcgattagaattatggtggaatctattttacgtcaacaattgagattgttaccc
gcctgttcttatttacaaggggaatatggcttaaacgatatttttctgggggttcccgcc
tggttaggttgtcggggagtagaacggattttggaactcgatttaaccgaatctgaacat
caagctttgatggaatgtagcacatcagttagagccggaattaatcaagccctagaattt
ttaggctag

DBGET integrated database retrieval system