KEGG   Planktothrix agardhii: NIES204_12870
Entry
NIES204_12870     CDS       T05658                                 

Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00030  Pentose phosphate pathway
pagh00051  Fructose and mannose metabolism
pagh00680  Methane metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_12870
   00030 Pentose phosphate pathway
    NIES204_12870
   00051 Fructose and mannose metabolism
    NIES204_12870
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_12870
   00680 Methane metabolism
    NIES204_12870
Enzymes [BR:pagh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NIES204_12870
    3.1.3.37  sedoheptulose-bisphosphatase
     NIES204_12870
SSDB
Motif
Pfam: FBPase_glpX
Other DBs
NCBI-ProteinID: BBD54003
UniProt: A0A2Z6CDG0
LinkDB
Position
complement(1549371..1550408)
AA seq 345 aa
MDNVIGLEIIEVVEQAAIASARLMGKGDKNGADHVAVEAMRKRMNQIHMRGRIVIGEGER
DEAPMLYIGEEVGICTQDDPSKFCNPDELLEIDIAVDPCEGTNLVAYGQNGSMAVLAISE
KGGLFAAPDFYMKKLAAPAVAKNHVDINKSATENLKILSDCMNRSIEDLVVVVMDRPRHK
DLINEIRTAGSRVRLISDGDVSAAISCAFSGTNIHALMGIGAAPEGVISAAAMRALGGHF
QGQLIYDPEVVKTGLIGESREGNLNRLEEMGINDADKVYDAHELASGETVLFAACGITPG
TLMQGVRFFSGGARTQSLVISSLSKTARFVDTVHMFGQPKNIQLH
NT seq 1038 nt   +upstreamnt  +downstreamnt
gtggataatgttattgggttagagattattgaagtcgtcgagcaagctgcgatcgcatcg
gctcgtttaatggggaaaggcgacaaaaatggggccgaccatgtggccgtggaagccatg
cgtaaacgcatgaaccaaattcacatgagaggacggatcgtaattggggaaggagaaaga
gacgaagcccccatgctttatattggtgaggaagtcgggatctgtacccaagacgatcca
tccaaattctgtaaccccgacgaactgctagaaattgatatcgccgttgacccctgcgaa
ggaactaacttagtcgcctatggtcaaaatggctccatggccgtcttagcaatttctgaa
aaaggcggtctatttgcggctcctgatttctacatgaagaaattagcagccccggcggtg
gctaagaatcacgttgatattaacaaatctgccaccgaaaacctgaaaattctttccgac
tgcatgaaccgctccattgaggacttagtggtggtggtcatggatcgtccccgccacaaa
gacctgatcaatgaaattcgcacagccggctcccgggtgcgtttgatcagtgatggagac
gtttctgctgccatttcctgtgccttttcgggaaccaatattcacgcactcatgggaatt
ggggctgcaccagaaggagtaatttctgctgctgccatgcgggctttaggcggtcacttc
caaggtcagttaatctatgatccagaagtggtgaaaaccggattgattggggaaagcaga
gaaggtaatctaaatcgcctcgaagaaatgggaatcaatgatgctgataaggtctatgat
gcccatgaattagcctccggtgaaacggtgttgtttgcggcttgtggaattacaccaggt
actttgatgcaaggcgtgcgcttctttagtggtggtgctcggactcaaagtttagttatt
tcttctctgtctaaaactgctcggtttgtcgatactgttcatatgtttggccaacccaaa
aatattcagttgcactaa

DBGET integrated database retrieval system