KEGG   Planktothrix agardhii: NIES204_12930
Entry
NIES204_12930     CDS       T05658                                 

Gene name
acnB
Definition
(GenBank) aconitate hydratase
  KO
K01682  aconitate hydratase 2 / 2-methylisocitrate dehydratase [EC:4.2.1.3 4.2.1.99]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01210  2-Oxocarboxylic acid metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_12930 (acnB)
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_12930 (acnB)
   00640 Propanoate metabolism
    NIES204_12930 (acnB)
Enzymes [BR:pagh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     NIES204_12930 (acnB)
    4.2.1.99  2-methylisocitrate dehydratase
     NIES204_12930 (acnB)
SSDB
Motif
Pfam: Aconitase_2_N Aconitase_B_N Aconitase Ketoacyl-synt_C
Other DBs
NCBI-ProteinID: BBD54009
UniProt: A0A2Z6CBX5
LinkDB
Position
1555841..1558465
AA seq 874 aa
MLQAYRQHAEERAQLGIPPLPLNAEQTAELCELLKNPPEEEKEFLMTLLRDRILPGVDEA
AYVKAAFLTAIAKDEITSPLISHQGAVSLLGTMVGGYNVQSLIDLLKARDENIAAAAATA
LSKTLLVFDAFHDVLHLSEVNPFAKQVIDAWAEADWFIGRPKLPKTITVTVFKVPGETNT
DDLSPATHATTRPDIPLHALAMLESRIPGGLETIAELKKKGHSVAYVGDVVGTGSSRKSA
INSVLWYIGNDIPYVPNKRSGGYILGGKIAPIFFNTAEDSGALPIECDVSKLNTGDVITI
YPYKGEITNEAGEVISTFTLKPDTILDEVRAGGRIPLLIGRSLTDKTRQALGLELSNLFV
RPTPLTKGGSRGDQTAKGFTLAQKMVGKACGLAGVRPGTSCEPLMTTVGSQDTTGPMTRD
ELKELACLGFSADLVMQSFCHTAAYPKPVDIKTHQQLPDFFSTRGGVALRPGDGIIHSWL
NRMLLPDTVGTGGDSHTRFPLGISFPAGSGLVAFAAALGVMPLDMPESVLVRFKGELQPG
VTLRDIVNAIPYVAMQQGKLTTEKANKKNVFNGRIMEMEGLPDLKVEQAFELTDATAERS
CAGSTIKLSQETIAEYLCSNVALMTNMVARGYQDAKTMMRRVAKMEQWLANPVLMAADSD
AEYADIIEVDLNLIKEPIVAAPNDPDNIKLMSECTGDKIDEVFIGSCMTNIGHYRAAAKI
LEGAPKTSVRLWICPPTRMDEKQLRDEGIYEVFDAVGARTEMPGCSLCMGNQARVADGVT
VFSTSTRNFNNRMGKDARVYLGSAELAAVCALLGRIPTVEEYREIVTKKVDPFAADLYRY
LNFDQIAGFEDEGRVIPLEEMPKIEDILGIPALT
NT seq 2625 nt   +upstreamnt  +downstreamnt
atgctacaagcctatcgtcaacacgccgaagaacgcgcccaactgggaattccgcccctt
cccctcaacgccgaacaaaccgccgaactctgcgaactcttgaaaaacccgccggaggag
gagaaagaattcttgatgacactactcagagaccgtatcctccccggtgtcgatgaagcc
gcttatgtcaaagccgcctttttaaccgccatcgccaaagacgaaattaccagccccctg
atatcccatcaaggtgccgtttcccttttaggtacaatggtaggcgggtataacgtccaa
tctttaatcgacttacttaaagcccgtgatgagaatattgccgccgccgccgctaccgcc
ctcagcaaaacgttgttagtcttcgacgccttccatgatgttctgcatttatcagaggtt
aacccctttgctaaacaagttattgacgcttgggcggaagcagactggtttatcggacgt
ccgaaactgccgaaaaccattaccgtaactgtctttaaagtcccaggggaaaccaacacc
gatgacctttcccccgctacccacgccaccacccgccctgatattcccttacacgcctta
gctatgttggaaagtcggataccgggagggttagaaaccattgccgaactgaagaaaaaa
gggcattctgtcgcttatgtcggagatgtggttggtacgggttcatctcgtaaatcggcg
attaactcagtgttgtggtatattggcaatgatattccctacgtccccaataaacgctca
gggggttatattctggggggaaaaattgcccctattttctttaataccgccgaagactcc
ggcgctttacccatcgaatgcgatgttagtaaactgaatactggggatgtgattactatt
tatccctataaaggagaaattaccaacgaagccggagaggtgatttctacctttaccctc
aaaccggatactattttagatgaagtcagggccgggggtcggattcccttattaattggt
cgcagcttaaccgataagacccgtcaagcattaggtttagaactttctaatttatttgta
cgtccaaccccccttactaaggggggatcaaggggggatcaaaccgcaaaaggctttacc
ctggcccagaaaatggtcggaaaagcctgcgggttggcgggagtacgtccggggacatcc
tgcgaaccgttgatgaccacagtaggttcccaggataccacaggcccgatgacccgggat
gaactgaaagaactcgcctgcttaggattttcggctgatttggtgatgcagagtttctgt
cacaccgcagcataccccaagcccgttgacatcaaaacccatcaacaattacccgatttc
ttctccactcggggcggtgtagccctgcgtccgggggatgggattattcactcttggtta
aatcggatgttgttacccgatacggtgggaactgggggcgactcccacacccgttttccc
ctggggatttccttccctgcgggttcggggttggtagcatttgccgcagcactcggtgtg
atgccgttggatatgccggaatcggtgttagtcagatttaaaggagaattacaaccgggt
gttaccctacgcgatattgtcaacgccattccttacgttgccatgcagcaaggcaagtta
acgacggagaaggcaaacaagaaaaatgttttcaatggtcggattatggaaatggaaggc
ttaccagatttaaaggtggaacaagcctttgaattaaccgatgcaacggcagaacgttcc
tgtgctgggtctacgattaagctcagtcaagaaactattgctgagtatttatgttccaat
gttgccctaatgactaatatggtcgcccggggttatcaagatgctaaaacgatgatgcga
cgggtggcaaaaatggaacaatggttagcaaatccggtgttaatggcggctgatagcgat
gcggaatatgctgatattatcgaagtggatttgaacctgatcaaagaacccattgtggcg
gctcccaatgaccccgataatattaagttaatgtccgaatgtacgggagacaaaattgat
gaggtgttcattggttcttgtatgacgaatattgggcattatcgggcggctgctaagata
ttagaaggggcgccaaaaaccagtgttcgtctgtggatttgtcccccaactcgcatggat
gaaaagcaattgcgggatgaaggaatttatgaggtttttgatgcagttggggcgagaacg
gagatgccgggatgttccctttgtatgggaaatcaggcgcgagttgctgatggggtaacg
gtgttttctacctcgactcgcaacttcaataaccgcatgggtaaagatgcgcgggtctat
ttaggttcggcggaattagcggcggtttgtgcgttattaggacgcattccaacagttgag
gaatatcgggaaattgtgactaagaaagttgacccgtttgcggcggatttataccgttat
ttgaactttgatcaaattgctggatttgaagatgaaggtcgggtaattccattagaagaa
atgccgaaaattgaagatattttgggtattccggcgttgacctaa

DBGET integrated database retrieval system