KEGG   Planktothrix agardhii: NIES204_13050
Entry
NIES204_13050     CDS       T05658                                 

Gene name
icd
Definition
(GenBank) isocitrate dehydrogenase, Icd
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00480  Glutathione metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01210  2-Oxocarboxylic acid metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_13050 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    NIES204_13050 (icd)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     NIES204_13050 (icd)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-ProteinID: BBD54021
UniProt: A0A2Z6CBY1
LinkDB
Position
complement(1564975..1566399)
AA seq 474 aa
MYDKITPPTTGEKVTFNNGEPIVPNNPIIPFIRGDGTGIDLWPATEKVLDAAIAASYGDQ
RKISWFKVYAGDEACELYGTYQYLPEDTTTAIREYGVAIKGPLTTPIGGGIRSLNVALRQ
IHDLYACVRPCKYYTGTPSPHKTPEKLDVIIYRENTEDIYLGIEWRQGSEIAEKLIHFLN
TELIPATPEHGKKQIRLDSGIGIKPISKTGSQRLVRRAIYQALRLPKNKQMVTLVHKGNI
MKYTEGAFRDWGYELATTEFRNECVTERESWILGNKEKNPDLSLEDNARQIEPGYDSLTP
EKKAEISQEVEGVLNTIWETHGNGKWKEKIMVNDRIADSIFQQIQTRPDEYSILATMNLN
GDYLSDAAAAMVGGLGMGPGANIGDECAIFEATHGTAPKHAGLDRVNPGSLILSGVMMLE
YMGWQEAADLIKKGLSGAIANQEVTYDLARLMEPPVEPLKCSEFADAIIKHFND
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtacgacaaaatcactccaccgaccacaggcgagaaagttaccttcaacaatggcgaa
cccattgtcccgaataatccgattattccgttcattcggggagatggtacagggattgac
ctctggcccgctaccgagaaagttttagacgcggctattgcagcctcctacggagatcaa
cgtaaaattagttggtttaaagtctacgccggggacgaagcctgcgaactctacggcact
tatcaatatttaccggaagacaccaccaccgccatcagggaatatggtgtcgccatcaaa
gggcctttaactactcccatcggaggcgggattcggtctttaaatgtggcattacgacaa
attcatgatctgtatgcctgtgtacgtccgtgtaaatattacactggaaccccttccccc
cacaaaaccccagaaaaattagatgtgattatctatcgggaaaataccgaagatatttat
ttaggaattgaatggcggcagggatcagaaatcgcggaaaaattaattcattttctgaat
acggagttaattccggcgactcctgaacatgggaaaaaacaaattcgccttgattctggc
attgggattaaacccattagtaaaactggttctcaacggttagttcgtcgggctatttat
caagcgttgcgtctacctaaaaacaaacaaatggtgacgctggtgcataaaggtaatatt
atgaaatataccgaaggagccttccgagattggggttatgaactggcaactacggaattt
cgcaatgaatgtgtcaccgaacgggaatcttggattttagggaataaagaaaaaaatccc
gatctatctttagaggataatgctcgtcaaattgaaccgggttatgattccctaactcct
gagaaaaaagcggagatttctcaagaagtggaaggagttcttaataccatttgggaaact
cacggtaatgggaaatggaaggaaaaaattatggtcaatgaccggattgccgatagtatt
ttccaacagattcaaacccgtcccgatgagtattctatcctggctacgatgaacttaaac
ggggattatttatccgatgcggctgccgccatggtcggaggtttaggcatgggcccaggg
gcaaatattggcgatgaatgtgctatttttgaggcaacccatggcactgcacccaaacac
gccggactggatcgggttaacccaggatctctgattctatcgggggtgatgatgttagaa
tatatgggttggcaagaagccgctgatttgattaaaaaagggttaagtggagcgatcgct
aatcaagaagtcacttatgatttagctcggttaatggaacccccggttgaacccttgaaa
tgttcagaatttgctgatgcaattattaagcatttcaatgattaa

DBGET integrated database retrieval system