KEGG   Planktothrix agardhii: NIES204_13610
Entry
NIES204_13610     CDS       T05658                                 

Gene name
pta
Definition
(GenBank) phosphate acetyltransferase
  KO
K13788  phosphate acetyltransferase [EC:2.3.1.8]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00430  Taurine and hypotaurine metabolism
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_13610 (pta)
   00640 Propanoate metabolism
    NIES204_13610 (pta)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_13610 (pta)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NIES204_13610 (pta)
Enzymes [BR:pagh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.8  phosphate acetyltransferase
     NIES204_13610 (pta)
SSDB
Motif
Pfam: PTA_PTB DRTGG AAA_26
Other DBs
NCBI-ProteinID: BBD54074
UniProt: A0A2Z6CCZ6
LinkDB
Position
1617357..1619447
AA seq 696 aa
MISNLYITSIEPDSGKSLILLGIMELLSKRIRKLGFFRPIIQAGIKPDNDIELIRSRYHL
EFPYQDYYGVTHEETRALIAEGQFEEILKRIIEKYKALEEKCDFIVCEGTDFTDIISAFE
FNFNAEIANQLDAPILLVANGQGKSQEEVISSVKSERKAFIEKDLTLVATMVNRISSEQF
LSVTQELEQIWCYDDPVFILPEIEALSKPTVGEIITALDAKFVHGDPEQLKQEVLSFKVA
AMHVPNFLYHIREGCLIVTPGDRADIILACLASAFSETYPNIAGIILTGGFELPPSLQKL
IQGFKKWTVPMFTVETDTYNTATIINNIHSKITPDNERKIASALGLFENHIDSSKIEKRI
SLSRSSHITPIMFEYELVARAKKQRQHIVLPEGTEERILKATEILLRRGIVDITLLGNPE
EIREKATSLGIKLEGVNIVNPMTSPWHEDYAQTYYQLRKHKGITEDCALDVMHDLSYFGT
MMVHKGMADGMVSGAIHTTGHTIRPALEFIKTPPGCSIVSSVFFMCLEDQVLVYGDCAVN
PNPNPQQLADIAISSALTAQQFGVEPLVAMLSYSTGESGQGKDVDKVREATLIARQLRPD
LKIEGPIQYDAAVDEGVAQTKLPGSEVAGHATVFIFPDLNTGNNTYKAVQRSANAVAIGP
VLQGLNKPVNDLSRGCTITDIVNTVAITAIQAQGIN
NT seq 2091 nt   +upstreamnt  +downstreamnt
atgattagcaacctatatattactagcattgaacccgatagcggtaaatccttaattctg
ttaggaattatggaattactctcgaaacgcatccgaaaattaggatttttccgtccaatt
attcaggcgggaattaaaccggataatgatattgagctaattcgcagtcgctatcattta
gagtttccctatcaagattattatggcgttacccatgaagaaactagggctttaattgcg
gagggacagtttgaagaaatcctgaaacggattattgagaaatataaggctttagaagaa
aaatgtgattttattgtctgtgaaggtacggattttactgatattatttctgcctttgaa
tttaactttaatgcggaaattgctaatcaactagatgcgccgattttattggtagcgaat
ggacagggaaaaagccaagaagaagtgattagtagtgttaaaagtgaacgaaaagctttt
atagaaaaggatttaactcttgtggcaacaatggttaatcggatttcttcagaacaattt
ttatccgttacccaggaattagaacagatttggtgttatgatgatccggtatttatttta
cctgaaatagaagctctttctaaacctactgttggggaaattattactgcccttgacgct
aaatttgtccatggcgatcctgaacaattaaaacaggaagtgttatcgtttaaggtggcg
gcgatgcacgttcctaattttctttatcatattcgagaaggctgtttaattgttacccct
ggagatcgggctgatattattttagcttgtttagcgtcggctttttcagaaacttacccc
aatattgccggaattattttaactggggggtttgaattgcctccttccctgcaaaaactg
attcaaggatttaaaaaatggacagtgccgatgtttacggtagaaacagatacctataat
actgcaaccatcattaataatattcactcaaaaattacccccgacaatgaacgaaaaatt
gcttctgctttaggactttttgaaaaccatattgatagctctaaaattgaaaaacggatt
tctctatcccgttcttcccatattactccgattatgttcgagtacgaactggtcgcccgg
gcgaaaaaacaacgtcaacatattgtcttacccgaaggcacagaagaacgaattttaaaa
gccactgaaattctattaagacggggaattgtcgatattactttattaggaaatcccgaa
gaaattcgcgaaaaagcaacttcactaggcataaaattagaaggggtaaatattgttaat
cccatgacctccccctggcatgaagactatgctcaaacctattatcaactgcgaaaacat
aagggaattacggaagattgtgccttagatgtgatgcacgatttaagttattttggcacg
atgatggttcataaaggcatggctgatggcatggtttctggggctattcataccactgga
catactattcgtcccgccttagaatttattaaaactccaccgggatgttcaattgtttcc
agtgtgttttttatgtgtttagaagaccaggttttagtctatggagattgtgcggtaaat
cctaatcctaacccccaacaattagccgatattgccattagttcggccttaactgctcaa
caatttggagttgaacctttagtagcaatgttatcctattctaccggagaatcaggacaa
ggtaaagatgtggataaagttcgagaagccacattaattgcccgtcaattacgccccgat
ttaaaaatagaaggccccatccaatacgatgcggccgttgatgaaggggtagctcaaact
aaactaccaggaagcgaagtggctggacacgcaacggtatttattttccccgatttaaac
accggaaataatacttataaagccgtacaacggtctgcgaatgctgttgccattggcccg
gttttacaaggtttaaataaacccgttaatgatttaagtcggggctgtacgattaccgat
attgtgaataccgttgcgattaccgctattcaagcccagggaataaattag

DBGET integrated database retrieval system