KEGG   Planktothrix agardhii: NIES204_14000
Entry
NIES204_14000     CDS       T05658                                 

Definition
(GenBank) malic enzyme, NAD-binding
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00620  Pyruvate metabolism
pagh01200  Carbon metabolism
pagh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_14000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NIES204_14000
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     NIES204_14000
SSDB
Motif
Pfam: malic Malic_M ACT ACT_4 ThiF ELFV_dehydrog F420_oxidored AlaDh_PNT_C DpnD-PcfM NAD_binding_8
Other DBs
NCBI-ProteinID: BBD54111
UniProt: A0A2Z6CC62
LinkDB
Position
1655043..1656434
AA seq 463 aa
MVSLTPNPSYSVTIRLELPNRAGMLASVFQAIATVGGNLGQIDLMEQTLHKTIREISVDA
SSEEHAEQIVQAVKGLTELKVLAVYDRTFNLHRAGKISIQSKIPLKSQSDLAMAYTPGVG
RICQAIAEDPEQIYKLTIKQNTVAIITDGSAVLGLGNLGPGAALPVMEGKAMLFKEFGDI
DAFPICLDTQDTDKIIETVKYLAPVFGGINLEDIAAPRCFEIEAKLRECLDIPIFHDDQH
GTAIVSLAALINSLKLVKKSREDIHLVLNGAGAAGVAMARLFKKAGVRNITLCDSKGIIS
HNRTDINEQKREFAVNLSGTLADAMKDADVFMGVSAPGVVTPEMVRSMAKDPIVFAMANP
IPEIQPELILNDVAVVATGRSDYPNQINNVLAFPGLFRGALDCGAKSLTISMYLEAANAI
ASLVSPTDLDREYVVPSVFDKRVATAVASAVTHTARQEGLART
NT seq 1392 nt   +upstreamnt  +downstreamnt
atggttagcttaacaccgaatcctagttatagcgttacaattcgtctggaactgcctaac
cgcgccggaatgttggctagtgtttttcaagcgatcgccaccgtcggaggaaatttaggt
caaattgacttaatggaacaaactctgcacaaaacaattcgagaaattagtgtagatgcc
tctagtgaagaacacgcagaacaaattgtccaagcggtaaaaggtttaactgagttaaaa
gtattagcggtttatgaccgaacatttaatctccatcgcgccggaaaaatcagtattcaa
agtaaaattcccctgaaatctcaatcggatttagccatggcttatactccgggtgtgggt
cgaatttgtcaagcgatcgcagaagatccagaacaaatttataagctgacaatcaaacaa
aataccgtcgctattattactgatggtagtgcggttttaggcttaggaaatttggggcca
ggtgcagctttacccgtgatggaagggaaagccatgctctttaaagaatttggagatatt
gatgcctttccgatttgtttggatacccaagatacagacaaaattatcgaaacggttaaa
tatcttgccccagttttcgggggaataaatttagaagatattgccgcccctcgctgtttt
gaaattgaagctaaactgcgggaatgtttagatattccgatcttccatgatgatcaacat
ggcacggcaattgtgagtttagccgccttaattaattccttaaaattagttaaaaaatca
cgggaggatattcacctggttttaaacggggcgggtgctgcgggggtagcaatggcgcgt
ttattcaaaaaagccggagtgcgtaatattaccctctgtgattctaagggaattattagc
cataatcgcaccgatattaacgaacaaaaacgggaatttgccgttaacttatcgggaact
ttagcggatgcgatgaaagatgctgatgtgtttatgggagttagtgcccctggtgtggtg
acaccggaaatggtaagatctatggcaaaagatcctattgtttttgccatggctaatccg
attcctgaaattcaaccggaattaattcttaatgatgtcgcagtcgtggcaacaggacgg
agtgattatcccaatcaaattaataatgttttagccttccctggtctattccgaggagcc
ttagattgtggggctaaaagtttaactatttcgatgtatttagaagcggcaaatgcgatc
gcttctttagtctctcccacggatttagatcgggaatatgttgtgccttcagtgtttgat
aaacgggtggctacggcggttgctagtgccgttacccataccgcccgtcaagaaggttta
gcccgcacttaa

DBGET integrated database retrieval system