KEGG   Planktothrix agardhii: NIES204_14690
Entry
NIES204_14690     CDS       T05658                                 

Definition
(GenBank) aspartate alpha-decarboxylase
  KO
K01579  aspartate 1-decarboxylase [EC:4.1.1.11]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00410  beta-Alanine metabolism
pagh00770  Pantothenate and CoA biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NIES204_14690
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NIES204_14690
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.11  aspartate 1-decarboxylase
     NIES204_14690
SSDB
Motif
Pfam: Asp_decarbox
Other DBs
NCBI-ProteinID: BBD54180
UniProt: A0A2Z6CCT2
LinkDB
Position
complement(1741072..1741515)
AA seq 147 aa
MGIIKLMHAKLHRVRVTEAKRDYVGSLTIDSDLLEKVGMLPLEEVQIVNINNGNRWSTYV
LPGEAGSGIVCPNGGAALLCQKDDLLIIWANEQCDRSEILKNGHEAKIIVADENNHCQEL
LYQTLTPNQGSVEFHSLPGIPEGHTSS
NT seq 444 nt   +upstreamnt  +downstreamnt
atgggtataatcaaactaatgcacgcaaaacttcatcgggtcagggttacagaggcaaag
cgtgactatgttggtagtttaaccatagactcagacttgttagaaaaggtaggaatgtta
cctttagaagaagtacaaatcgtcaatatcaataatggcaaccgttggtcaacctatgtt
ttaccaggtgaagcaggttctggcatagtttgtccaaatggtggggcagcactgctatgt
cagaaagatgatctactaattatttgggcaaatgaacaatgcgatcgctccgaaatctta
aaaaatggacacgaagcgaaaataatcgtggctgatgaaaataatcattgtcaagaactt
ctctatcaaactctaactccaaatcaaggaagtgttgaatttcactctttgccaggaatt
ccagaaggtcacacatcgtcatga

DBGET integrated database retrieval system