KEGG   Planktothrix agardhii: NIES204_14880Help
Entry
NIES204_14880     CDS       T05658                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pagh  Planktothrix agardhii
Brite
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NIES204_14880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BBD54199
UniProt: A0A2Z6CCN5
LinkDB All DBs
Position
1762297..1762899
Genome map
AA seq 200 aa AA seqDB search
MAFELPALPFADDALESSKMSAKTFSFHHGKHHAAYVTNLNKLIDGTGLADKSLEEIIKA
TANDPNKAGIFNNAAQVWNHTFFWNSLKAGGGGQPTGALADKINADFGSFDKFIEEFKAA
ATTQFGSGWAWLVLNNGTLKVTKTANAGTPIVDGLTPLLTLDVWEHAYYLDFQNARPAYI
ENFLNQLVNWDFVAENFAAA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtggcttttgaacttcccgccctaccctttgccgacgatgctttagaatctagcaaaatg
tcggccaagaccttttccttccatcatggtaagcaccacgcggcttatgttacgaacctg
aataaactgattgatgggacaggactagcggataaatccctagaggaaattatcaaggca
accgccaatgacccgaataaagctggaattttcaacaatgcggctcaagtctggaatcat
actttcttctggaatagtctgaaagctggtggcggtggccaacccacaggcgctttagcc
gacaaaattaatgctgactttggtagctttgacaaatttattgaagaattcaaagccgcc
gcgactactcaatttggtagtggttgggcttggttagtattaaataatggcactctgaaa
gttaccaaaaccgctaatgcaggaactcctattgtggatggattaactcctttattaact
ttagatgtttgggaacacgcctattatttagacttccaaaatgccagacctgcttacatt
gaaaacttcctaaatcaattagtgaactgggattttgtggctgaaaacttcgctgctgca
taa

DBGET integrated database retrieval system