KEGG   Planktothrix agardhii: NIES204_14980
Entry
NIES204_14980     CDS       T05658                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K15633  2,3-bisphosphoglycerate-independent phosphoglycerate mutase [EC:5.4.2.12]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00260  Glycine, serine and threonine metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_14980
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_14980
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_14980
Enzymes [BR:pagh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     NIES204_14980
SSDB
Motif
Pfam: Metalloenzyme iPGM_N Phosphodiest Lactamase_B Sulfatase
Other DBs
NCBI-ProteinID: BBD54209
UniProt: A0A2Z6CCP3
LinkDB
Position
complement(1771775..1773373)
AA seq 532 aa
MAPKSVSPVVLIILDGWGYREQADGNAIAVANTPVMDSLWMAYPRTLIRTSGKAVGLPVG
QMGNSEVGHLNIGAGRVVPQELVRISDAVEDGTIQNNPALLKVCQDVLDKNGKLHLMGLC
SDGGVHSHLDHLYGLLNLAKAKNIRDVCVHAIMDGRDTNPKDGIKYIKQLQEQIDAIGIG
RIVTISGRYYAMDRDKRWDRVKQAYDVIITDGEGNGLSAADVMLSSYSEGINDEFVVPCR
IAPGSVEAGDGVIFFNFRPDRARELTQVFIDANFKDFERSYIQPLSFVTLTQYDSHFPVL
VAFEPQNLNNILGQVIAEHGLKQLRTAETEKYAHVTYFFNGGLEQPYPGEDRELIPSPSV
ATYNLQPEMSAEAVTDVAIEGIEKGIYSLIVINYANPDMVGHTGMMEAAVKAVETVDHCL
GILLQGISQAGGTAIIIADHGNAEYMCDAEGNPWTAHTTNPVPFILVEGEKRKIPGHGTD
IPLRTDGCLADIAPTILQILGIPQPPEMTGVSMIESAAYEVRENRTPMRVKL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggcaccaaaatctgtatctccggttgtactgattatcttggacggatggggttatcgt
gaacaagccgacggaaatgccatagccgttgccaataccccggtgatggatagtctatgg
atggcttacccccgaactttaattcgcacctctgggaaagccgtgggcttacccgtgggg
caaatgggaaattcagaagtgggtcatttgaatattggtgcggggcgcgttgttccccaa
gaattagttagaatttccgatgcggttgaagatggcacaattcaaaataacccggcattg
ttaaaagtctgtcaagatgttttagataaaaacggcaagttacacttgatgggtttatgt
tctgatggtggtgttcactcccatttagatcatttatacggacttttaaacttagcaaaa
gctaaaaatattagagatgtttgtgttcatgccattatggatggtcgagacactaatcct
aaagatggaattaaatatattaagcaacttcaagaacaaattgatgctattggtatcggt
cgaattgtaacaattagtggccgttattatgccatggatcgagacaaacgatgggatcga
gttaaacaagcttatgatgtcataattaccgatggcgaaggtaatggattatccgccgcc
gatgtgatgttatcttcctattctgaaggcataaacgatgagtttgtggtgccctgtaga
atcgcgcctgggtcggtggaagccggggatggggtgattttctttaacttccgtcctgac
cgggcaagggagttaactcaggtgtttattgatgctaattttaaggattttgaacgttcc
tatattcagcccctgagctttgtaactttaactcaatatgactctcattttcccgtatta
gtagcttttgaaccccaaaatctaaataatattctcggacaagttattgctgaacacggg
ttaaaacaattacgcacggcggaaaccgaaaaatatgcccatgtcacctatttttttaat
ggcggtttggaacaaccctatccgggggaagaccgagaattaattcccagtccctccgtt
gctacatacaatttacaaccggaaatgtcggccgaagctgtaacagatgtggcaattgaa
ggtattgaaaagggcatttactccctaattgtaattaattacgctaatcctgatatggtc
ggacatacggggatgatggaggcggcagtaaaagccgttgaaaccgttgatcactgttta
gggatattgttacaaggtattagtcaagctggggggacggcgattattattgccgatcat
ggtaacgccgaatatatgtgcgacgcggaaggaaatccctggacagcccacacaactaac
cccgttccctttatcctagtagaaggggaaaaacgcaaaatcccaggtcatggaaccgat
attcctttacggacagatggctgtttagcggatatcgcgcctacgattttgcagattttg
ggtattcctcaacccccggaaatgacgggtgtttctatgattgaatccgccgcctatgaa
gttcgggaaaatcggactccgatgcgggtaaaactttaa

DBGET integrated database retrieval system