KEGG   Planktothrix agardhii: NIES204_15480
Entry
NIES204_15480     CDS       T05658                                 

Gene name
accA
Definition
(GenBank) acetyl-CoA carboxylase alpha subunit
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00061  Fatty acid biosynthesis
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01212  Fatty acid metabolism
Module
pagh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_15480 (accA)
   00640 Propanoate metabolism
    NIES204_15480 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NIES204_15480 (accA)
Enzymes [BR:pagh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NIES204_15480 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NIES204_15480 (accA)
SSDB
Motif
Pfam: ACCA Carboxyl_trans ECH_1
Other DBs
NCBI-ProteinID: BBD54258
UniProt: A0A2Z6CCX8
LinkDB
Position
complement(1829582..1830562)
AA seq 326 aa
MANSNRKPILLDFEKPLVELESRIDQIRQLANENGVDVSDEILQLEARASQLRQEIFSGL
SPLQRLQLARHPRRPSTLDYIQAMTDEWMELHGDRRGYDDPALVGGVARLGGQPVVILGH
QKGRDTKDNVARNFGMAAPGGYRKAMRLMEHANRFGMPILTFIDTPGAWAGVDAEKLGQG
EAIAYNLREMFDLEVPIICTVIGEGGSGGALGIGVGEKLLMLEYSVYTVATPEACAAILW
KDAGQAPQAAQALKITSKDLKQLGIIDQVVPEPDGGAHSNPLKAAELLKKALIQSLGELL
ALTSQQRQEMRYQKFRNIGVFAEAKV
NT seq 981 nt   +upstreamnt  +downstreamnt
gtggctaattctaatcgaaaaccgattctccttgactttgaaaagcctctagttgagcta
gaaagccgaattgatcaaattcgtcagttagcgaatgaaaatggtgtggatgtgtccgat
gaaatcctacaactcgaagcccgcgccagccaattgcgacaagaaattttcagtggttta
tctcccttacaacggctacaactggctcgccatccccgtcgccccagtaccctagattat
attcaagccatgaccgatgaatggatggaactccatggcgatcgccggggttatgacgat
cccgcgttggtgggaggtgtagctcgtttagggggacaacctgtggttatcctcggtcat
cagaaaggacgggataccaaagataacgtcgcccgtaattttgggatggccgcccccggt
ggttatcggaaagcgatgcgcctgatggaacacgctaaccgctttgggatgccaattctg
acctttattgatactcctggggcttgggcgggagtggacgccgaaaaattaggccaagga
gaagcgatcgcctataacctacgagaaatgtttgatttagaggttccaattatctgtact
gttattggtgagggtggttccggtggggcgttaggtattggtgtgggtgaaaaactgctg
atgttagaatattcggtttatactgtagctacccccgaagcctgcgccgcgattttgtgg
aaagatgcgggtcaagctccccaagcggcccaagcattgaaaatcacctccaaagacctc
aaacaattaggcattattgatcaagttgtacccgaacccgatggaggcgcccatagcaac
cctttaaaggcagcagaactactgaaaaaggctttaattcaatctttaggggaacttctg
gctttaacatcccagcagcgtcaagaaatgcgctatcagaaatttagaaatattggagtt
tttgcagaagctaaggtttaa

KEGG   Planktothrix agardhii: NIES204_24140
Entry
NIES204_24140     CDS       T05658                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00061  Fatty acid biosynthesis
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01212  Fatty acid metabolism
Module
pagh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_24140 (accD)
   00640 Propanoate metabolism
    NIES204_24140 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NIES204_24140 (accD)
Enzymes [BR:pagh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     NIES204_24140 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NIES204_24140 (accD)
SSDB
Motif
Pfam: Carboxyl_trans zf-ACC
Other DBs
NCBI-ProteinID: BBD55113
UniProt: A0A2Z6CGP4
LinkDB
Position
complement(2735180..2736142)
AA seq 320 aa
MSLFDWFANRRKLLPNTPEPQEREIADGLWVKCEKCNALTYAKDLQANNKVCLECGHHFM
VNSDERIGQLIDPNTWMALDAEMYAVDPLKFRDRKSYSDRLRETREKTGLSDAVQTGIGL
LEGEPVALGVMDFRFMGGSMGSVVGEKLTRLIEHGTNEGYPVVIICASGGARMQEGMLSL
MQMAKISAALHRHRKSRLLYIPVLTHPTTGGVTASFAMLGDMILAEPKATIGFAGRRVIE
QTLREKLPDDFQTSEYLLNYGFVDAIVPRTQLKKTLAQLIRLHRLPQTSGPLSHTAEVIP
LTSGDTPIDLSQGVSASKSV
NT seq 963 nt   +upstreamnt  +downstreamnt
atgtctctatttgattggttcgcaaatcggcgtaaattattacccaacactcccgaaccg
caggaacgagaaattgctgatgggctatgggttaagtgcgaaaagtgcaatgctttaact
tatgccaaagacctacaagccaataataaggtttgtttggaatgcggtcatcatttcatg
gtcaatagcgacgagcgaattgggcaattgattgatcctaatacctggatggctttagat
gccgaaatgtatgcggttgatcccctgaaatttcgcgatcgcaaatcctatagtgatcga
ctccgagaaacccgggaaaaaaccggattatccgatgcggtacaaaccggaatcggctta
ctcgaaggtgaacccgtggccctgggagtcatggacttccggtttatgggcggtagcatg
ggttcagtggtcggggaaaaactcacccgcctgattgaacatggcactaatgaaggctat
cccgtggtgattatttgtgcctccgggggcgcgaggatgcaggagggaatgttaagtctg
atgcagatggcgaaaatctccgccgccttgcatcgccaccgcaaatcccgactgctgtat
attcccgtcctcacccatcccaccaccggaggggtgacggccagttttgccatgttaggg
gatatgattttagccgagccaaaagcgactattggttttgctggaagacgggtaattgaa
caaaccctgagagagaagttacccgatgatttccaaacctcagaatacctattgaattat
gggtttgtggatgccattgttccccgtacccaactcaaaaaaaccctagcccaattgatt
cgcctccatcgtcttccccaaacctccgggcccttatcccatactgctgaagttatcccc
ctaacttcgggtgatacacccatagatttatctcagggtgtctcagcgtctaagtcagtc
tag

KEGG   Planktothrix agardhii: NIES204_27340
Entry
NIES204_27340     CDS       T05658                                 

Gene name
accB
Definition
(GenBank) biotin carboxyl carrier protein
  KO
K02160  acetyl-CoA carboxylase biotin carboxyl carrier protein
Organism
pagh  Planktothrix agardhii
Pathway
pagh00061  Fatty acid biosynthesis
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01212  Fatty acid metabolism
Module
pagh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_27340 (accB)
   00640 Propanoate metabolism
    NIES204_27340 (accB)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NIES204_27340 (accB)
SSDB
Motif
Pfam: Biotin_lipoyl Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 HlyD_D23
Other DBs
NCBI-ProteinID: BBD55426
UniProt: A0A2Z6CGC4
LinkDB
Position
complement(3069889..3070425)
AA seq 178 aa
MQLDLNQLRELLADLDKTNISELTLKSADFELTVRKEVSPGSQALSSVETLLTAAGVGSQ
LVSSPVVPTAIVPPVGENLTTATPATPVAAPPPLSPESKWVEITSPMVGTFYRSPAPDEA
PFVEIGDRISTGQSVCIIEAMKLMNEIEAEFSGQVMEILIQNGSPVEYGQPLIKIKPD
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgcaactagatttgaaccagcttcgtgaactgctggctgatctcgataaaactaatatt
tcagagctaacactcaaaagcgcagattttgaactgaccgttcgtaaagaagtttcgccc
ggatctcaggctttatcctcggttgaaactctgttaacggctgcgggggttggttcacag
ttggtgtcgtctccggtggtacccactgcgattgttcctccagttggggaaaatctcact
acagcgaccccagcaacgccagtggctgctcctccacctctttcgccggaatcgaagtgg
gtcgaaattacttcccccatggtgggaaccttttatcgttctcctgcacctgatgaagcg
ccttttgtggaaattggcgatcgcatttctacgggtcagagcgtttgcattattgaagcc
atgaagttgatgaatgaaattgaagcggaattttctggccaagtcatggaaattttaatt
caaaatggttctcccgttgaatatggccagccattaattaaaattaaacccgattaa

KEGG   Planktothrix agardhii: NIES204_40530
Entry
NIES204_40530     CDS       T05658                                 

Gene name
accC
Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00061  Fatty acid biosynthesis
pagh00620  Pyruvate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01212  Fatty acid metabolism
Module
pagh_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_40530 (accC)
   00640 Propanoate metabolism
    NIES204_40530 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NIES204_40530 (accC)
Enzymes [BR:pagh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     NIES204_40530 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     NIES204_40530 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_5
Other DBs
NCBI-ProteinID: BBD56720
UniProt: A0A2Z6CK78
LinkDB
Position
4474137..4475489
AA seq 450 aa
MRFSKILIANRGEIALRILRTCEEMGIATVAVHSTVDRHALHVQLADEAVCIGEPSSSKS
YLNIPNIIAAALTRNATAIHPGYGFLAENARFAEICADHDIAFIGPTPHAMRSMGDKSTA
KETMQRVGVPTVPGSDGLLSDDKEALQLACKIGYPVIIKATAGGGGRGMRLVREDSELPK
LFAAAQGEAEAAFGNPGVYLEKFIERPRHIEIQILADNYGNVIYLGERDCSIQRRHQKLL
EEAPSSFITPKLRQKMGTAAVKAAKSINYTGAGTVEFLVDQSGNFYFMEMNTRIQVEHPV
TEMITGLDLIAEQIRIAQGEKLLLTQNQVILRGHSIECRINAEDPEHNFRPHPGRISGYL
PPGGNGVRIDSHVYTDYEIPPYYDSLIGKLIVWGPDRPTAILRMKRALREFAITGVPTTI
GFHQKILENPEFLRGEIYTNFVEKMMKKGE
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcgattctcaaaaatattaattgccaatcgaggggaaatagctttacggattcttcgc
acctgcgaggaaatgggtattgcgacggttgctgttcattcaacggtggatcgccacgcc
cttcatgtccaactagccgatgaagccgtttgtatcggggaacccagcagcagtaaaagc
tatttgaatattcccaatattatcgccgccgccctgactcgtaacgccacggccattcat
cccggctatggatttttagccgaaaacgcccgatttgccgaaatttgtgccgatcatgat
attgccttcattggccccacaccccacgctatgcggtcaatgggagacaaatcaacggcc
aaggaaaccatgcaacgggtcggagttcctactgtaccgggcagtgatggactcctgagt
gatgacaaagaagccctacaactggcctgcaaaatcggttatccggtgattattaaagcc
accgcaggggggggaggtcggggaatgcggttagttagggaagattcggaactccccaaa
ctctttgccgccgcccaaggggaagcggaagccgcctttggtaacccgggggtttatttg
gagaagtttattgaacgtcctcgccatattgaaattcagattttagctgataattatggc
aatgtaatttacttaggagaacgggattgttcgattcaaagacgtcaccaaaaactatta
gaagaagcaccaagttcttttattactcctaaactgcgtcaaaagatgggaacggcggcg
gtaaaagcggctaaatctattaattataccggggcaggaaccgttgaatttctagttgat
cagtcgggcaatttctattttatggaaatgaatacccggattcaagttgaacatccggta
acggaaatgatcaccggattagatttaattgctgaacaaattcgcatcgcccaaggggaa
aagttattattaactcaaaatcaagtaattttgcgcggtcattccatcgaatgtcggatt
aatgccgaagatcctgaacataatttccgcccccaccccggacgaattagtggttattta
cctcctgggggaaatggggtgagaattgattcccatgtctatacggattatgaaattcct
ccctattatgattctttaattgggaaattaattgtttgggggccagatcgtccgacggcg
attttaagaatgaaacgggcgttacgggaatttgcgattacgggagttccgacaacgatc
ggatttcatcaaaaaatattagaaaatcccgaatttctccgaggggaaatttatacaaat
tttgtggaaaaaatgatgaagaaaggagaatag

DBGET integrated database retrieval system