KEGG   Planktothrix agardhii: NIES204_17160
Entry
NIES204_17160     CDS       T05658                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00002  Glycolysis, core module involving three-carbon compounds
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_17160
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_17160
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     NIES204_17160
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N
Other DBs
NCBI-ProteinID: BBD54423
UniProt: A0A2Z6CEL0
LinkDB
Position
complement(2015356..2016375)
AA seq 339 aa
MIKVAINGFGRIGRNVLRCWLTRQNSNLEFVGINDTSDPSTNAHLLKYDSMLGTLKGVDI
KANENSITVNGKTIKCVSDRNPLNLPWKEWGVDLIIESTGVFITEEGASRHITAGAQKVL
ITAPGKGEGVDTFVVGVNHHDYNHDQHRILSNASCTTNCLAPFAKVLHEKFGIVKGTMTT
THSYTGDQRLLDSSHRDVRRARAAAVNIVPTSTGAAKAVSLVIPELKGKLNGIAFRVPTP
NVSIVDLVVQVEKATFVEEVNLALKEAADGAMKGILEYSDLPLVSSDYKGHDASSIVDAS
LTMVMGGDMVKVVAWYDNEWGYSQRVVDLAELVASNWKA
NT seq 1020 nt   +upstreamnt  +downstreamnt
gtgattaaggtcgcaatcaacggttttggacggattggacgtaacgttttacgctgctgg
ttaacccggcaaaatagcaatttagagtttgtgggcatcaatgatacttccgatcccagt
accaatgcccatttgctcaaatacgattccatgctcggcacactcaaaggcgttgatatc
aaagccaatgagaattccattacagtcaatggcaaaaccattaaatgtgtttctgatcgt
aacccattaaatttgccttggaaagaatggggtgtggatttaattattgaatccaccggg
gtatttattaccgaggaaggtgcttctaggcatattaccgccggagcccaaaaagtcctg
attacggctcctggaaagggtgaaggcgtggatacttttgtggtgggtgtgaatcaccat
gactacaatcatgatcaacaccgaattctgagtaacgccagttgtactaccaactgttta
gctccttttgccaaagtcctgcatgagaaattcggcattgttaaaggcacaatgaccaca
acccacagctatactggagatcagcgtcttttagattccagtcaccgcgatgtgcgtcgg
gctagagccgcggcggtgaatattgttcctacttctacgggtgctgcaaaggccgtttct
ttagtgattcctgaactgaaaggaaaactcaacgggattgcttttcgagttcctacccct
aatgtctcgattgtggatttagtggtacaggtggagaaggcaacctttgttgaagaagtc
aatttagctctgaaagaagctgctgacggcgcaatgaaagggattctggaatacagcgat
ctgcctttggtgtcttctgactataaaggacatgatgcttcttcaattgtggatgccagc
ttaacaatggtgatgggtggcgacatggtgaaagtagtcgcctggtatgataacgaatgg
ggttatagtcaacgggtggttgatttagccgaattggtagcttccaactggaaagcctag

DBGET integrated database retrieval system