KEGG   Planktothrix agardhii: NIES204_20370
Entry
NIES204_20370     CDS       T05658                                 

Gene name
gdhA
Definition
(GenBank) glutamate dehydrogenase
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00220  Arginine biosynthesis
pagh00250  Alanine, aspartate and glutamate metabolism
pagh00471  D-Glutamine and D-glutamate metabolism
pagh00910  Nitrogen metabolism
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    NIES204_20370 (gdhA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NIES204_20370 (gdhA)
   00220 Arginine biosynthesis
    NIES204_20370 (gdhA)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NIES204_20370 (gdhA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_20370 (gdhA)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     NIES204_20370 (gdhA)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   NIES204_20370 (gdhA)
SSDB
Motif
Pfam: ELFV_dehydrog ELFV_dehydrog_N 2-Hacid_dh_C NAD_binding_7
Other DBs
NCBI-ProteinID: BBD54741
UniProt: A0A2Z6CDV4
LinkDB
Position
complement(2358639..2359928)
AA seq 429 aa
MVSSPVRINPAPTPAYICPYDRTCSYLGQAAVELDLDDNVLVVLQQPRKVVTVSIPVKLD
NGKVEVLAGHRVQHCDVLGPYKGGLRYHPSVNLGELSALAMLMTWKCALLGIPYGGAKGG
IGFDPHQYSINELERITRRYASELIKDIGPETDIPAPDVGTSAREMAWIMDTYSMNMGRA
VLGVVTGKPLSIGGSKGREMATGRGVMITVREALAEQGKSLEGAAIVIQGFGKVGAAAAQ
LFYEAGATVLSVSNVHGGIYSENGLDIPALQAYATQNNHDITGFPDSEPISNAELLTLAC
DVLIPAAMEDQITEENADQIKAKMIAEAANAPITLLADQMLEARGIMVLPDILANAGGVV
VSYWEWVQGQSFVFWDEERVNQEMEHLMVQAYTRVSELAKQRGVSMRLAAYTLGVGRVAQ
ALKDRGLYP
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggtatcctctcccgtcagaattaatcccgcaccgactccagcctatatttgtccctac
gatcgcacctgtagctatttaggacaagcggcggttgaattggatcttgatgacaatgtg
ctggtggtattacaacaaccccgcaaagttgtcaccgtctcaattccagtcaaacttgat
aacggtaaagttgaggttttagccggacatcgtgtgcagcattgcgatgtacttggcccc
tataaaggaggtttacgctatcatccttcggtgaacttgggggaactctccgctctagcg
atgttaatgacctggaaatgtgctttattggggattccctacgggggtgctaaaggtggc
attggctttgacccccaccaatatagtattaacgagttagaacggatcacccgtcgctac
gcgagtgaactgattaaagatattgggccagaaaccgatattcccgcccccgatgtggga
acttccgctcgagaaatggcttggattatggatacctattcaatgaatatgggaagggcg
gtgctgggtgtggtgactggaaaacccctatctattggtgggtcgaaaggacgggaaatg
gcaaccggacgaggtgtaatgattaccgtgcgcgaagccttagccgaacagggcaaatcc
ctcgaaggtgcagcgattgtgattcagggttttggaaaagtgggggcggcggcggcgcaa
ttgttttatgaagccggggcgacggttttatcggtttctaatgtccatggtgggatctat
tcagaaaatggcttagatattcctgccctgcaagcctacgcgactcagaacaatcatgat
atcacgggatttcctgatagtgaaccgattagcaatgccgaattattaacattagcttgt
gatgtgttaattccggcggccatggaagatcaaattaccgaagaaaatgccgatcaaatt
aaggctaaaatgatcgccgaagcagctaatgccccgattacattattggcggatcaaatg
ttagaagcccggggaattatggttttacccgatattttagccaatgcgggcggcgtggtc
gtcagttattgggaatgggtacaaggtcaatcctttgtcttctgggatgaagaacgggtg
aatcaggagatggaacacctgatggtacaagcctatactcgggtgagtgaactagcgaaa
caacggggggtttccatgcgattagccgcctatactttaggcgttggtcgagtggctcaa
gccttaaaagatcggggtttgtatccgtaa

DBGET integrated database retrieval system