KEGG   Planktothrix agardhii: NIES204_20910
Entry
NIES204_20910     CDS       T05658                                 

Definition
(GenBank) methylenetetrahydrofolate reductase
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00670  One carbon pool by folate
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NIES204_20910
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     NIES204_20910
SSDB
Motif
Pfam: MTHFR
Other DBs
NCBI-ProteinID: BBD54795
UniProt: A0A2Z6CEE1
LinkDB
Position
2408840..2409730
AA seq 296 aa
MNRFRTACQTLDEFIVTAEVAPPKGADPSQMIEMVRLLKGRVHAVNITDGSRAVLGMSSL
AASIILIHHGVEPIYQLACRDRNRIGLQADLLGAQALGIRNVLALTGDPVKAGDHPDAKA
VFDLESVRLLQAIDKLNQGKDWNNKTLPDGATDLFPGAAVDPQSSSWSGLKSRFERKIEA
GAQFFQSQLITDFDRLDKFMTEIADSSKKPILAGIFLLKSAKNARFINKYVPGVCIPDSI
IDRLEQAKHPLEEGILIASEQVKIARELCHGVHIMAVKREDLIPEILDLAGIKPLF
NT seq 891 nt   +upstreamnt  +downstreamnt
atgaatcgttttcgtactgcttgtcaaactttagatgaatttattgtgacggcggaagtc
gccccccccaaaggtgcagaccctagccagatgattgaaatggtcagactcctcaaaggt
cgagttcatgcggttaatattaccgatgggagtcgggctgttttaggaatgagttccctg
gccgcttcgattattttgatccatcatggggtagaaccgatttatcaattggcttgtcgc
gatcgcaatcggattggtttacaagcggatttattaggagcccaagcgttaggaattaga
aatgttttagccttaactggtgatccggtcaaagctggagatcatcccgatgctaaggcg
gtttttgacttagaatctgtgcgcttattacaagcaattgataaactaaatcaaggcaaa
gattggaataataaaaccctacccgatggggcgacggatttatttcctggggcggcagtt
gacccccaatcttccagttggtcagggttaaaaagccgatttgaacgtaaaatagaagcg
ggggcgcagttttttcaaagtcaattaattacggattttgatcggttagataaattcatg
actgaaattgctgatagtagtaaaaagccgattttagccggaatatttctattaaaatct
gctaaaaatgctagatttattaataaatatgtccctggggtttgtattcccgattcaatt
attgatcgtttagaacaggctaaacaccccctagaagaaggcattttaatcgcatcagaa
caggttaaaattgcccgtgaactttgtcatggagtacatattatggcggttaaacgggaa
gatttaattcctgaaattttggatttggcgggaataaaacctttgttttaa

DBGET integrated database retrieval system