KEGG   Planktothrix agardhii: NIES204_22210
Entry
NIES204_22210     CDS       T05658                                 

Gene name
serA
Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00270  Cysteine and methionine metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_22210 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_22210 (serA)
   00270 Cysteine and methionine metabolism
    NIES204_22210 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pagh04147]
    NIES204_22210 (serA)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     NIES204_22210 (serA)
    1.1.1.399  2-oxoglutarate reductase
     NIES204_22210 (serA)
Exosome [BR:pagh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NIES204_22210 (serA)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2
Other DBs
NCBI-ProteinID: BBD54921
UniProt: A0A2Z6CEA6
LinkDB
Position
2540702..2542285
AA seq 527 aa
MSKVLVSDSIDQVGIDILSQVAQVDVKIGLPPEELVRIIPEYDALMIRSGTHVTQEIIEA
ANNLKIIGRAGVGVDNVDIPAATRKGIVVVNSPQGNTIAAAEHALTMMLSMSRYVPDANQ
SVKTGQWDRKSFVGVEVYKKTLGIVGLGKIGSHVAAVAKAMGMKLLAYDPFISQERADQI
GCRLVDLDLLIQESDYITLHIPKTKETYHLFNAEVFAKMKPTARLINCARGGVIDETALA
DALRTGQIAGAALDVFENEPLEADSSLRELGSKIVLTPHLGASTEEAQVNVAIDVAEQIR
DVLLGLPARSAVNIPGLYPDVLEKLKPYLQLAETLGNLVGQLAGGRVDFLDVRLQGELAG
TSSQAVVVASLKGLLSQALRERVNYVNAGIEAKERGIRVIETRDASVTDYTGSLHLEAKG
SLGTHSVTGALLGDHEIRITSVDDFPINVPPTRYMLFTLHRDVPGIIGNIGSLLGRFNVN
IASMQVGRKIVRGEAVMVLSLDDPLPEGILAEIIKVSGIRDAYTVTL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtctaaggttctcgtatccgattctattgatcaagttggtatagacatcctgtctcaa
gtggctcaggtggatgtcaaaataggtttacccccagaagaactggtgcggattattcca
gagtatgatgctttgatgatccggtctggaactcatgtaacccaagaaattattgaagcc
gccaataacttaaaaattattggtcgggcgggtgtcggtgtggataatgtggacattccc
gccgctacccgtaaagggattgttgtggttaattctccacaagggaacaccattgccgcc
gccgaacacgccctgacgatgatgctgtccatgtctcgctacgtccccgatgctaaccaa
tcggttaaaactggacagtgggatcgcaaaagcttcgttggtgtagaagtttataagaaa
accctgggtattgtgggtttgggtaaaattggttcccatgttgcggcggtggcgaaagca
atggggatgaaacttttggcctatgatccttttatatcccaagaacgagcggatcaaatt
ggttgtcggttagtggacttggatctgttgattcaggagtccgattatattacgctgcat
atccccaaaaccaaagaaacttatcatctgtttaatgcggaagtcttcgctaagatgaag
cccaccgcccgcctaattaactgtgctaggggcggtgtgattgatgaaacagccttagcc
gatgccctgcgaactggccaaattgccggggctgccttagatgtatttgaaaatgaaccc
ctagaagccgattcttccctgcgggaattggggtctaaaattgttctcactcctcacctg
ggagcctctacagaagaagctcaagtcaatgtggcgatcgatgtcgctgaacaaattcgg
gatgtgttgctgggcctgccagcccgttctgcggtgaatattcccgggttatatcccgat
gtcttggaaaaactcaaaccctatttacaattggcggaaactctgggtaatttggtcggt
cagttagccgggggacgggtggacttcctggatgtgcgtttgcaaggggaactagccgga
accagtagccaagcagtggttgtggcttctctgaaggggttactgtcccaagcattacgc
gagcgggtgaactatgttaacgcaggtattgaagccaaggaacgggggatcagagtaatt
gaaacccgtgatgcttcggtgacggactacaccggatcactacatttagaagctaagggc
agtttaggcactcattctgtgaccggggcgttattaggggatcacgaaattcggatcacc
agtgtggacgattttccgattaatgttcctcccacccgctatatgttgtttactctccac
cgggatgtaccgggaattattggtaacattggctcgcttttgggcagatttaatgtcaat
attgccagtatgcaagtcggacgtaaaattgttcggggtgaggctgtcatggttttaagt
cttgatgatcctttacctgaaggtattcttgcagaaattatcaaagtgtctggcatccgc
gatgcctatactgtaacgctttaa

DBGET integrated database retrieval system