KEGG   Planktothrix agardhii: NIES204_22400
Entry
NIES204_22400     CDS       T05658                                 

Gene name
pdhB
Definition
(GenBank) pyruvate dehydrogenase E1 beta subunit
  KO
K00162  pyruvate dehydrogenase E1 component beta subunit [EC:1.2.4.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_22400 (pdhB)
   00020 Citrate cycle (TCA cycle)
    NIES204_22400 (pdhB)
   00620 Pyruvate metabolism
    NIES204_22400 (pdhB)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     NIES204_22400 (pdhB)
SSDB
Motif
Pfam: Transket_pyr Transketolase_C AAA_26 Flu_NP
Other DBs
NCBI-ProteinID: BBD54940
UniProt: A0A2Z6CF62
LinkDB
Position
2556745..2557755
AA seq 336 aa
MIHARLSTIAMAPTLLFNALKQATDEEMARDPRVFVLGEDVGQYGGSYKVTKDLYEKYGE
LRVLDTPIAENSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNGGMLRYTSGGNFK
MPLVIRGPGGVGRQLGAEHSQRLESYFQSVPGLKMVACSTPYNAKGLMKAAIRDDNPVLF
FEHVLLYNLKEEIPDEEYIVPIDKAEIVRRGKDVTILTYSRMRHHVMQAVPTLVKQGYDP
EVIDLISLKPLDFDTIGESIRKTHRVVIVEECMKTGGLGAEITASINDRLFDELDAPVLR
LASQDIPTPYNGALERLTIVQPEQIVEGVKSIISYQ
NT seq 1011 nt   +upstreamnt  +downstreamnt
gtgatccacgctcgcttatcaacaattgcaatggcaccaaccctactttttaacgccctg
aaacaagcaaccgatgaagaaatggctcgtgaccccagagtgttcgtgttgggggaagat
gtgggtcaatatggcggttcctataaagttactaaggatctttatgaaaaatacggggaa
ttacgggttttagatactccgattgccgaaaatagttttacaggaatggctgttggtgct
gccatgactgggttgcggccgattattgaaggcatgaatatgggatttttgttactcgcc
ttcaaccaaattgctaacaacggcggaatgctgcgctatacttccgggggaaattttaaa
atgcccctggtgattcgtggccctggaggtgtgggccgtcaactgggggcggaacactcc
caacgcttagaatcctatttccagtctgttcccggcttaaaaatggtcgcctgttcgact
ccctataatgctaagggattaatgaaagcggcgattagagatgataacccggtgctattt
tttgagcacgttctgttatacaacctcaaggaagaaatccccgacgaggaatatattgtt
cctattgataaggcggaaatagtcagacgggggaaagatgtaacaattctgacctattct
cggatgcgccatcatgtcatgcaagcggttcctactctggtcaaacagggttatgatcca
gaagtgattgatttaatttctcttaaacctctcgattttgacacgataggggaatctatt
cgcaaaacccatcgggtagttatcgtggaagaatgtatgaaaaccgggggactgggggcg
gaaattaccgcttcaattaatgatcgtctatttgatgaattggatgcacctgtattaaga
ttggcgtctcaagatattcctacaccttataacggtgctttagaacgactgactattgtg
caaccggaacaaattgttgagggagttaaatcaattatcagttatcagtaa

KEGG   Planktothrix agardhii: NIES204_31380
Entry
NIES204_31380     CDS       T05658                                 

Definition
(GenBank) pyruvate dehydrogenase E1 alpha subunit
  KO
K00161  pyruvate dehydrogenase E1 component alpha subunit [EC:1.2.4.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_31380
   00020 Citrate cycle (TCA cycle)
    NIES204_31380
   00620 Pyruvate metabolism
    NIES204_31380
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     NIES204_31380
SSDB
Motif
Pfam: E1_dh TPP_enzyme_C Transketolase_N DXP_synthase_N
Other DBs
NCBI-ProteinID: BBD55820
UniProt: A0A2Z6CHP2
LinkDB
Position
complement(3534951..3535982)
AA seq 343 aa
MVQERTLPTFKADANAVTRDEGLMLYEDMVLGRLFEDKCAEMYYRGKMFGFVHLYNGQEA
VATGMIRAGRRDEDYVCSTYRDHVHALSAGVPPREVMAELFGKATGCSKGRGGSMHLFSS
AHNLLGGFAFVAEGIPVATGAAFQTKYRREAINDPNADQVTMCFFGDGACNNGQFYECLN
MAALWNLPIIYVVENNKWAIGMAHDRATSDPEIYKKGPAFGMPGYEVDGMDVLAVREVAK
KAVARARAGEGPTLVEALTYRFRGHSLADPDELRDKDEKEFWFARDPIKKFAAHLTEHNL
ATHEELKAIDQQVQAIIDDAVEFAQSSPEPDPKELYRYIYADD
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggtacaggaacgcacgttaccgacgtttaaggcggatgcaaatgctgtaacccgcgat
gaagggttaatgctgtatgaggatatggtgctggggcggctatttgaagataaatgtgcc
gagatgtattatcggggcaaaatgttcggttttgtccacctgtacaacggtcaagaagcc
gtggctacggggatgatccgggcgggtcgtcgggatgaggattatgtttgtagtacctat
cgggatcacgttcatgctttgagtgcgggggttccaccccgggaagttatggcggaatta
tttggtaaggccacaggttgttctaagggtcggggcggctcgatgcacctattctcctcg
gcccataatttattaggggggtttgccttcgttgctgaggggattccggtggctacaggg
gcggcttttcaaaccaaataccgcagggaagcgatcaatgatccgaatgccgatcaggta
actatgtgtttctttggggatggcgcttgtaataacggccaattctatgaatgtttgaat
atggcggcattatggaatttgccaattatttatgtggtggaaaataataaatgggcgatc
ggcatggcccatgaccgggcaacttctgacccggaaatctacaaaaaaggcccggctttt
ggaatgcctggttatgaagtggatgggatggatgttttggcggttagggaagtggctaaa
aaggccgttgctcgcgcccgggcgggtgaaggcccaactttagttgaagctttaacctat
cgttttcgtggacattctttggccgatcccgatgaattacgcgataaagatgagaaggaa
ttttggtttgctcgtgatccgattaaaaaatttgcggctcatttaaccgaacataatttg
gcaacccatgaggaattgaaagctattgatcagcaagttcaagccattattgatgatgcg
gtagaatttgcccaaagtagcccggaacctgatcctaaagagttgtatcgttatatttat
gccgatgattaa

DBGET integrated database retrieval system