KEGG   Planktothrix agardhii: NIES204_22820
Entry
NIES204_22820     CDS       T05658                                 

Definition
(GenBank) transketolase-like protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_22820
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_22820
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    NIES204_22820
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     NIES204_22820
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-ProteinID: BBD54982
UniProt: A0A2Z6CFC6
LinkDB
Position
complement(2602614..2603555)
AA seq 313 aa
MRSAFATALVKAAQLDDRVVLLTGDHGYALFDEFRQVCPQQYINAGVAEQNMIGVAAGLA
KSGFRPVVYGLSAFLPIRVLEQIKLDICYQQLPVVLMGDGAGVVYSSLGSSHQSTEDIAV
LRALPNISILSPADGYEMTQCMSLALNADCPVYLRMGKADLGDIHNSLPELSWGQLCPIK
SGIGEIGFIATGSMVKTALQTAQKFDDSSVWSVPSVKPIDVNQIVTICKQHRTVVVLEEH
SIYGGLGSVVAEIATTYAPTWICRIGIQDRFSHFCGSYEYLMGEHNLDTNSVLEQIGTFL
CKAAMIDANINLH
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagaagtgcttttgcgactgctttggtcaaagcggctcaattagatgatcgagttgtt
ttgttgacaggcgatcatggctacgccttatttgatgaatttcgtcaagtttgccctcaa
cagtatatcaatgcaggtgtggctgaacaaaatatgattggtgtagcggctggacttgct
aagtctggctttagacctgttgtatatgggttaagcgcatttcttcccatacgggtgcta
gaacagattaagttggatatttgttatcaacaattaccagtggtactgatgggcgatggt
gcaggagttgtttacagtagtttagggtcaagccaccaaagcactgaagatatagctgtt
ttgcgagctttgccaaatatatcaattctttcaccagccgatggctatgaaatgactcaa
tgtatgagtttagcccttaatgcagattgtccagtatatttgcgaatgggtaaagctgat
ttgggagatattcataattctctcccagagctaagttggggtcagttatgtcctattaag
tcaggaatcggtgaaatcggatttattgctactggttctatggttaaaactgcattacaa
actgcccaaaagttcgatgatagttccgtatggagtgtaccttcagtgaagccaatagat
gttaaccagattgtcactatttgtaaacagcatcggactgtagtagtattagaagaacat
tcaatatatgggggtttggggtctgtggtggctgaaattgcaactacgtatgctcccaca
tggatatgtagaattgggattcaggatagattttctcatttctgtggtagttatgaatat
cttatgggagaacataatttagatacaaattcagtgttagagcagatagggacttttttg
tgtaaagctgctatgattgatgctaatattaatttacattag

KEGG   Planktothrix agardhii: NIES204_22830
Entry
NIES204_22830     CDS       T05658                                 

Definition
(GenBank) transketolase-like protein
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_22830
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_22830
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    NIES204_22830
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     NIES204_22830
SSDB
Motif
Pfam: Transketolase_N E1_dh DXP_synthase_N XFP_N TPP_enzyme_C
Other DBs
NCBI-ProteinID: BBD54983
UniProt: A0A2Z6CGA5
LinkDB
Position
complement(2603570..2604376)
AA seq 268 aa
MSLLFESKQLRKTVLEMAYAGSTVHISCAFSLIEILAVLYRSHLNLGNGKPESPERDYLV
LSKGHGVMAQYACMRELGWLTDADIQNYFSNGTILKGLSDAHVPGLEVTSGSLGHGLSVG
VGLALAAKRRQTGQRCFAIVGDGEINEGAIWEALMFASHFELDNLLVIVDENGYQAMGKT
EEIIRLGHISDKFQSFGFETRDVDGHDEFALDATIRELMEISSNQPRAIVAHTVKGKGIS
FMEGNNQWHYTRLTPNSYASAISELDNQ
NT seq 807 nt   +upstreamnt  +downstreamnt
atgtcattattatttgaatctaaacagcttcgtaagactgttttagaaatggcttatgcc
ggatcaacagtacatatttcctgtgctttttctcttattgaaattttagctgttctttac
cgttcgcacttgaatttaggaaacggaaaaccagaatcacctgagcgagattatcttgtg
ttgagcaagggtcatggtgtgatggctcaatatgcttgtatgcgggaactaggttggtta
actgatgccgatattcaaaattactttagcaatggcacaattttaaaaggcttgtcagat
gctcatgtacctggactagaggtaacttcagggtcgttgggtcatggactctctgtggga
gtgggattggctttggcagcaaaacgccggcagacgggacagaggtgttttgctattgtg
ggagatggtgaaattaatgaaggggcgatttgggaagcattaatgtttgcatctcatttt
gaacttgataatttgttagtaattgttgatgaaaatggctaccaagcaatgggaaagacg
gaagagattatcaggttaggccatatcagcgataaatttcaatcttttgggtttgaaact
cgtgatgtggatggccatgatgaatttgctttggacgcgactattcgagagttaatggag
atatcatctaatcaacccagagccattgttgctcatacagttaagggaaaaggtatttct
tttatggaaggaaataaccaatggcactacactcgcttgactcctaatagttatgcgtct
gcgatttctgagttagataaccaataa

KEGG   Planktothrix agardhii: NIES204_28510
Entry
NIES204_28510     CDS       T05658                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_28510
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_28510
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    NIES204_28510
Enzymes [BR:pagh01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     NIES204_28510
SSDB
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DUF3429 DUF498 PKD_2
Other DBs
NCBI-ProteinID: BBD55542
UniProt: A0A2Z6CGW6
LinkDB
Position
3223959..3225965
AA seq 668 aa
MVDPAQSLEELCINSIRFLAIDAVEKAKSGHPGLPMGAAPMAFVLWDRFMRFNPKNPKWY
NRDRFVLSAGHGCMLQYALLYLTGYDSVTLDDIKQFRQWGSRTPGHPENFETEGVEVTTG
PLGQGIANGVGLAMAEAHDAATFNKPDAALVDHYTYVILGDGCNMEGVSGEACSLAGHLG
LGKLIALYDDNHISIDGNTEISFTEDVSKRFEAYGWHVLHVENGNTDLDGIADAIAKAKA
VTDKPTFIKVTTIIGYGSPNRQNTAGVHGAALGADEVAATRKNLGWNYEPFEIPEDALAH
TRKAVERGANLETEWNKTWADYKAKYPQEAAEFERRTSGILPEGWEKSLPTFTPDEKGKA
TRQYSEGCLNALAPAIPELIGGSADLTHSNLTEIKGFGNFQKGQYQNRNLRFGVREHGMG
AICNGIGLHGSGLVPYCATFLVFADYMRAAIRLAALSEIGVIYVMTHDSIALGEDGPTHQ
PVETIASLRVIPNLLVMRPADGNETSGAYKIAVENRHRPTLIALTRQALPNLNGSSIDVV
GKGAYVLSDSEGTPDLILIGTGSEVSLCVEVAEKLTQVGKKVRVVSMPCWELFEEQDAAY
KESVLPKAVTKRLAVEAGCGFGWQRYTGSEGDSISIDTFGASAPGGVLMEKFGYTVDNVL
AKAKALLG
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggttgatccagcccaatcacttgaagaactttgcattaattcgattcgcttcctagcc
attgatgcggtagaaaaagctaaatccggccacccaggattaccaatgggtgccgcgccc
atggcctttgtgttgtgggatcggtttatgcggttcaatcccaaaaatcctaaatggtat
aaccgcgatcgcttcgtcctatccgcaggtcatggctgtatgttgcagtatgccctcctt
tatttaacgggatatgatagcgtcaccttagatgatattaaacaattccgtcagtggggt
tctcggactcctggccacccagaaaactttgaaactgagggtgtggaagttaccactggc
cctttaggtcaagggattgccaatggcgttgggttagcgatggccgaagctcatgacgcg
gcgaccttcaataaacccgatgctgcactggtagaccactatacctatgtgatcctgggt
gatggttgcaacatggaaggggtttctggtgaagcctgttccttagcgggacatctggga
ctgggtaaattaattgccctttatgacgataatcatatttctattgatggaaataccgag
atttcctttaccgaagatgtgagcaaacggtttgaagcctacggctggcacgttctgcac
gttgaaaatgggaataccgacttagatggtatcgccgatgctattgctaaagccaaggct
gtcaccgataaacccactttcattaaagttaccaccatcattggttacggttctcccaac
agacaaaatactgctggagttcacggagccgctttgggcgcagatgaagtggccgcgact
cggaaaaacctgggttggaactatgaaccctttgaaattcctgaagatgccttagcccat
acccgcaaagccgttgaacgtggggctaatctggaaactgaatggaataaaacttgggct
gactataaagccaaatatccccaagaagctgcggaatttgaacgccgcaccagtggaata
ctccccgaaggttgggaaaaatccttaccgacattcactcccgatgaaaaaggtaaagcc
actcgccaatattccgaaggatgtctgaatgccttagctccggctattcccgaattaatt
gggggttcggcggacttaacccactccaacttaacggagatcaagggttttggtaatttc
caaaaaggacaatatcaaaatcgtaacctgcgtttcggtgttcgggaacacggaatgggg
gcaatttgtaatggtattggcttgcatggttcggggttagttccctattgtgctaccttc
ctagtctttgccgactatatgcgggcggcgattcgtttagctgctttatcggaaattggt
gtgatctatgtgatgacccatgactcgattgcccttggggaagatggccctacccaccaa
cctgtggaaaccattgcctccttgcgggtgattcctaacttgttggtgatgcgtccggcg
gatggtaacgaaacgtctggtgcgtataaaatcgctgtggaaaaccgtcatcgtcccaca
ttgatagccttaactcgccaagcattaccgaacttaaacggtagttctattgatgtggtc
ggcaaaggggcttatgttctgtccgatagcgaaggaactcccgatttaattctaatcgga
actggaagcgaggtttctctgtgtgtggaagtcgccgaaaaattaacccaggttgggaaa
aaagttcgggtggtttctatgccttgttgggaactgtttgaagaacaagatgctgcttat
aaagagtctgtgttacctaaagctgttaccaaacgtctggctgtggaagcgggttgtggt
tttggttggcaacgttacacaggtagcgaaggcgacagcatcagcattgatacctttggt
gcctcggctccgggtggtgtgttgatggagaaattcggttacaccgttgataatgttttg
gctaaggcgaaagcgttattgggttaa

DBGET integrated database retrieval system