KEGG   Planktothrix agardhii: NIES204_29800
Entry
NIES204_29800     CDS       T05658                                 

Gene name
glk_1
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00052  Galactose metabolism
pagh00500  Starch and sucrose metabolism
pagh00520  Amino sugar and nucleotide sugar metabolism
pagh00521  Streptomycin biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_29800 (glk_1)
   00052 Galactose metabolism
    NIES204_29800 (glk_1)
   00500 Starch and sucrose metabolism
    NIES204_29800 (glk_1)
   00520 Amino sugar and nucleotide sugar metabolism
    NIES204_29800 (glk_1)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIES204_29800 (glk_1)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NIES204_29800 (glk_1)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NIES204_29800 (glk_1)
SSDB
Motif
Pfam: ROK Hydant_A_N DUF4872
Other DBs
NCBI-ProteinID: BBD55664
UniProt: A0A2Z6CH47
LinkDB
Position
3364670..3365587
AA seq 305 aa
MNTVQVIGIDLGGTAIKLGCFAPDGTCYQSLTVPTPQPATPEAVLIAIVEAIAQIRKNVN
NIVAIGLGTPGPVDGTGKIAKVAINLAGWQDVPLADWLEEKTGLPVILANDANCAGLGEA
WLGAGRRFQNLILLTLGTGIGGAIILNGELFVGHQGAAAELGLISLNFDGPICNSGNRGS
LEQYTSVQAIRRDTGLEPAELAEKALAGDEKAIEYWQEYGKLLGIGLANLIYVLTPEAII
LGGGISAGADLFLPTMKAELEQRVLFSSREGLEILIAELGNQAGMIGAAKLAFQKFVKIE
DQIDS
NT seq 918 nt   +upstreamnt  +downstreamnt
gtgaacacagtgcaagttattgggatagatttaggtgggacggcgataaaattgggctgt
tttgcaccggatggaacttgttatcaatccttaacggttcccacacctcaaccagcgaca
ccggaagcggtgttaatagcaatagttgaggctatagcacaaatcaggaaaaatgtcaat
aatattgtggcaattggattgggaactcctgggcctgtggatgggacgggaaaaattgcc
aaagtagcgattaatttagccggatggcaggatgttcccttagctgattggttagaagaa
aaaacgggtttacctgtgattttagccaatgatgctaactgtgcggggttaggtgaagca
tggttaggggcggggagacggtttcaaaatttaatcctattaacattaggaacaggcatt
ggcggggcgattattttaaatggggaattatttgtcggacatcagggggcggcggcggaa
ttaggattaattagtcttaattttgatggccctatttgtaatagtggaaatcgaggttcc
ttagaacaatatacctcagttcaagctattcgccgggatacgggattagaacccgcagaa
ttagcggaaaaagccttagcaggggatgaaaaagctatagaatattggcaagaatacggc
aagttattagggataggattagcgaatctaatttatgtattaaccccagaagcgataatt
ttaggcgggggaattagtgcgggggctgatttatttttaccgacgatgaaagcggaatta
gaacaaagagtattattcagttccagagaggggttagaaatattaattgccgaattaggg
aatcaagcgggaatgattggggcggcaaaattagcgtttcagaagtttgttaagattgag
gatcaaattgattcataa

KEGG   Planktothrix agardhii: NIES204_29840
Entry
NIES204_29840     CDS       T05658                                 

Gene name
glk_2
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00052  Galactose metabolism
pagh00500  Starch and sucrose metabolism
pagh00520  Amino sugar and nucleotide sugar metabolism
pagh00521  Streptomycin biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pagh_M00909  UDP-N-acetyl-D-glucosamine biosynthesis, prokaryotes, glucose => UDP-GlcNAc
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_29840 (glk_2)
   00052 Galactose metabolism
    NIES204_29840 (glk_2)
   00500 Starch and sucrose metabolism
    NIES204_29840 (glk_2)
   00520 Amino sugar and nucleotide sugar metabolism
    NIES204_29840 (glk_2)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NIES204_29840 (glk_2)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    NIES204_29840 (glk_2)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NIES204_29840 (glk_2)
SSDB
Motif
Pfam: Glucokinase Fungal_KA1
Other DBs
NCBI-ProteinID: BBD55668
UniProt: A0A2Z6CGN8
LinkDB
Position
3369746..3370831
AA seq 361 aa
MTLLLAGDIGGTKTILRLVDGTEIVKDSQTQERLKTLYESRYLSGDYPDLVPIVKQFLQE
AQEQLGENLHPEKACFAIAGPVVHQTAKLTNLPWHLDAQYLGSELAISQVTLINDFEAVG
YGVTGLPESDLLVLQKGQHQADSPIGVIGAGTGLGQCFVTPLVNGIKVYPCEGGHTDFAP
RYELEFQLMKYLLAKHSIDRISVERVVSGPGIIAIYQFLRDTATQRWRDRNMATESPEIS
DIVKEWEHQIGLTEVTVDPAAAISQAALEKRDHLSEQTMQLFVESYGAEAGNLALKLLPY
GGLYIAGGIAPKILPLLETSEFMQAFSNKGRMKPILAKVPVYVVLNPQVGLIGAAVCAAI
F
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaccttattattagccggagatattgggggaacaaaaacgattttgcgcttggtggat
gggacggaaattgtgaaagatagccaaacccaagagcgattaaaaaccctctatgaatct
cgttatttaagtggggattatcctgatttagttcccattgtaaaacaatttttacaggaa
gcccaggaacaattaggagagaatctgcatcccgaaaaagcctgttttgccattgcgggg
ccagtagtgcatcaaaccgccaaattaactaatttaccttggcacttagatgctcaatat
ttagggtcagaattagctatttcccaggtgactttaattaatgattttgaggcggtagga
tatggggttacgggtttaccagaaagcgatcttttagtattacaaaaaggacagcatcag
gcggattcacctattggagtgattggggcgggaactggcttaggtcaatgttttgttaca
cctttagttaatggaatcaaagtctatccctgtgaaggcggtcatacggattttgcccca
cgttatgaattagaatttcagttaatgaagtatttattagctaaacatagtattgataga
atatccgtagaacgggtggtatctgggccagggattatagcgatttatcagtttttacgc
gatactgctacgcaacgctggcgcgatcgcaatatggctacagaatctccagaaattagc
gatattgtcaaggaatgggaacatcaaatcgggttaacagaagtaacagttgatcccgcc
gcggctatttctcaagctgctttagaaaaacgggatcatttatcagaacaaaccatgcag
ctttttgtagaatcctatggagcagaagcgggaaatttagcgttaaaactattaccttat
ggcgggttatatattgctggaggaattgcacctaagattttacctttattagaaacttct
gaatttatgcaggctttttctaataaaggacgcatgaaacccatcttagctaaagttccc
gtttatgtagtattaaatcctcaagtgggattaattggggcggcggtttgtgccgcgatt
ttttaa

DBGET integrated database retrieval system