KEGG   Planktothrix agardhii: NIES204_30120
Entry
NIES204_30120     CDS       T05658                                 

Gene name
ptsG
Definition
(GenBank) PTS system glucose-specific EIICB component
  KO
K02779  glucose PTS system EIICB or EIICBA component [EC:2.7.1.199]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00520  Amino sugar and nucleotide sugar metabolism
pagh01100  Metabolic pathways
pagh02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_30120 (ptsG)
   00520 Amino sugar and nucleotide sugar metabolism
    NIES204_30120 (ptsG)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    NIES204_30120 (ptsG)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.199  protein-Npi-phosphohistidine---D-glucose phosphotransferase
     NIES204_30120 (ptsG)
Transporters [BR:pagh02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Glucose-specific II component
    NIES204_30120 (ptsG)
SSDB
Motif
Pfam: PTS_EIIC PTS_EIIB Gate
Other DBs
NCBI-ProteinID: BBD55695
UniProt: A0A2Z6CH54
LinkDB
Position
3396473..3398311
AA seq 612 aa
MFKNAFALLQKMGKSLMLPVSVLPIAGLLLGLGSARLIELQNLASGTISSPKFWWLPEGL
ANIMKTSGDAIFGNLPIIFAISVAIGFAENDGVAALAATVGFVVFVASLGAASTTFFGMN
PEQLKPVMGIPSLDTGVFGGLIMGCVAAYLFNRYFRIQLPQYLGFFAGKRFVPIVTSFAA
IAMGILMSVVWPPIGAAISTAANAAASGGNVSLTAAIYGLVERLLLPFGLHHIWNVPFFF
QIGSFLDPITNRIVTGDINRFFAGDPTAGILGGAYWFKMFGLPAAAIAIWRTAKPKNRAL
TGGIMISAAFTSFLTGITEPIEFSFMFVAPPLYAIHAVMAGFCDWLFVALGGRMGFTFSQ
GFIDFFLFNGLGTKAWLIPALGPFFAALYFCVFYFGIRQFNFSTPGREDEVETVTTITPG
TGVGSMAMELVRAFGGRSNIATLDACITRLRITVNDIKKVNKPRLKALGASGVLEMGNSA
QAIFGPRSENLKTDMMEYLKNAGPEADFVEEIAPEATEVNATEAEISSPIISDSEAKNRI
QEIIIALGGKKNIQSVDAVALTRLRVKVIDNNLVDEDKLKTAGVEGILRLPDGILHLLVG
LGAEQYAAQIQD
NT seq 1839 nt   +upstreamnt  +downstreamnt
atgttcaaaaacgcttttgctttattacaaaaaatgggaaagtctttaatgcttcccgtt
tcggttttacccattgctggcttattattaggattgggtagcgctcgtttaattgaatta
caaaatctggcatcgggaacaatttcctcccctaaattttggtggcttcctgaaggttta
gcgaacattatgaaaacttccggggatgcaatttttggcaatttaccgattatttttgcg
atttccgttgccattggatttgcggaaaatgacggggtggctgctttagctgcaacggtg
ggatttgtggtttttgttgcttctttaggggcggcttctactactttctttggcatgaat
cccgaacaattaaaacctgttatgggcattccttccctagatacgggggtgtttggcggg
ttaattatgggctgtgttgccgcctatttatttaaccgttatttccgaattcaattacct
caatatctgggattttttgccggaaaacgatttgttccgattgtgacttcctttgcagcg
atcgccatgggaatcttaatgagcgtggtctggccgcccattggagccgcgatttctacg
gctgcaaatgccgctgcatctgggggaaatgttagtcttaccgccgcaatttatgggctt
gtagaacggttattattaccctttggattacatcatatttggaatgttcctttctttttt
caaatcggatcatttcttgatccaattaccaatagaatcgtaaccggagacattaatcgc
ttctttgctggcgacccaacggccggaattttagggggtgcttattggttcaaaatgttc
ggtttacctgcggcggcgatcgctatttggcggacagcaaaacccaaaaatcgagcgtta
actggcgggattatgatctctgctgctttcacctctttcttaaccggaattaccgaaccg
attgaattttcatttatgttcgtagccccgcctttatacgccattcatgcagtaatggcg
ggcttttgtgattggttatttgttgccttgggtgggcgcatgggatttactttttcccag
ggatttattgactttttcctgtttaatggattaggtacaaaggcgtggttaattcccgca
ttggggccgttttttgcggctttatatttctgtgttttttactttggaatccgacagttt
aatttctccactccgggtcgagaagatgaggtagaaaccgtaacaacgattaccccagga
accggagttggtagtatggcaatggagttagttcgagcttttggcggacgcagtaatatt
gctactttggatgcttgtattactcgattacgaatcacggttaatgatattaaaaaggtg
aataaaccccgactcaaagcattaggagcttcgggagttttagaaatgggaaatagtgct
caagctatatttggcccccgttcggaaaatttaaaaacggatatgatggaatatctcaaa
aatgcggggccagaggcggattttgttgaggaaatagcaccggaagcaacggaggttaat
gcaacggaagcggagatttcatccccaattatctcggattccgaggcaaaaaatcggatt
caggagatcataattgccttgggtggaaaaaagaatattcaaagcgttgatgctgtcgcc
ttaactcgattacgagttaaagttattgataataacctggttgatgaagataaattaaaa
accgcaggtgtggaaggaattttacgtttacccgatggtattttacatctattagtcggt
ttgggtgcggaacaatatgcagcccaaattcaagattga

DBGET integrated database retrieval system