KEGG   Planktothrix agardhii: NIES204_30150
Entry
NIES204_30150     CDS       T05658                                 

Definition
(GenBank) phosphoenolpyruvate synthase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00620  Pyruvate metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_30150
   00620 Pyruvate metabolism
    NIES204_30150
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_30150
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     NIES204_30150
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilizers PPDK_N
Other DBs
NCBI-ProteinID: BBD55698
UniProt: A0A2Z6CGR9
LinkDB
Position
3399955..3402405
AA seq 816 aa
MDNFYGLHEIQSDHRDFVGEPAFYLSQLLHQGHPVLPGFVVTDHLFWEFLETINWLEPRF
VDFPELSLYFDINQPRQLQIIAQHLCQQMMDSHLPPSSSQPIQDSIDKLKTSALIFYPSL
NTPHHLQTSGLFESVIGWADTQKALVGLKQAYCEFFRAKSLLYWQRYKIELQNLRPVVLV
QPLQSAIASGFVEIRPNCWEINSTWGLEFSLLWGESHPDIYLIQPQTGIIQQQLGSKTII
YNLKSSPDQPTKYPIPQKQFGTPISQFPISATLISEPQQIFSLTPEQLQQLIKIIQQIIQ
SNPAITRLDWRLFQQPQDQEPQFYLVGAKCSENSLYSNPIISDSSSNQQRFRGLALASGK
SRGTAYILTETDPIPSQLPENTVLVVTAITWDYLPLLKQIVAIVAEQGGMTSHGAIVARE
IGIPAVCGIVNATMKIKTGESIFVDGNYGEVYIIKKEFPVNKMFSQPSFQQQQLVEISSN
VNSTALMVNISQLSSLQRLDSLPIDGVGLLRSELMAIEVLERSEHPTINSWISQEIGSKF
YNFNDWILSEKQPIFVQKMAEQLDQIVTILSPRPVYYRAFDLREVEQSVSGLTYFYPHQP
LTNGGRGDQKLSSQDGIDRGNFLASESPSLERLALFDLELKVLLELYKSGDKNIHLILPF
IRSVEEFLIYKHRIEASQLSHYPEFQVWIMAEVPSILFLLPDYLKAGVQGISIGTNDLTQ
LLFGIDRNQMQVFPGLYESNPAFKKAIKQLIEMAKTANIPCSICGDAPALYPELIEDLVR
WGITSISVNLDAIESTYMAIAKSEKQIPLETSRHHL
NT seq 2451 nt   +upstreamnt  +downstreamnt
gtggataatttttatgggcttcacgaaattcaatctgatcatcgcgattttgttggggag
ccagccttttatttaagccaattactccatcagggtcatccggttttaccaggttttgta
gttacggatcatttattttgggagtttttagaaaccattaattggttagaaccccgattt
gttgatttccctgaattatctctgtattttgacatcaatcaaccccggcaattacaaatt
attgctcaacatctttgtcaacaaatgatggatagtcatttacctccgtcatcgagtcaa
cctattcaagacagcattgacaaattaaaaacctcagcgttgattttttatccgagtttg
aacactccccatcacttacagacatcgggactttttgaatcggtgatcgggtgggcggat
actcaaaaagctttagtgggattaaaacaagcctactgtgaattttttcgggcaaaaagt
ttattatattggcaacgatacaaaattgaattacaaaatttacgtccggtggtattagtt
caacctctccagtctgcgatcgcttccggttttgtggaaattcgccctaactgttgggaa
ataaactcgacttggggtttggaattttccctgttatggggagaaagccatcctgatatt
tatttaattcaaccccaaacgggaataattcaacaacaattaggctctaaaactattatc
tataatttaaaatcttctcctgatcaaccgacaaaatatccaattccccaaaagcaattc
ggaactccaatttctcaatttcctatttctgccaccttgatttctgaaccacaacaaata
ttttccttaacgccggaacaattacaacagttaattaagattattcaacaaattatacag
tctaatcccgccattactcgattagattggcgtttatttcaacagccccaagatcaagaa
cctcaattctatctagtcggggctaaatgttccgaaaacagtctttattctaatccgata
atatcagattctagctcgaatcaacagcgttttagaggactagccctagcctctggaaaa
tctaggggaactgcatatatcctaacagaaacagatccaatcccatcacaattacctgag
aatactgtgttagttgttacagcgattacttgggattatttaccattattaaaacagatt
gttgctattgtcgctgaacagggaggaatgaccagtcatggtgcaattgtggcgcgagaa
ataggtatacctgctgtttgtgggatcgtgaatgcaacaatgaaaataaaaacgggtgaa
tctatttttgtcgatggtaattacggggaagtttatattatcaaaaaagaatttcccgtt
aataaaatgttttcacaaccgagttttcagcaacaacaattggtcgaaatctcgtcaaat
gtaaactccacagccctgatggttaatattagtcaattgagttctctacagcgactcgat
tctttaccgattgatggagtgggtttattgcgttcagaattaatggctattgaagtatta
gaacgttctgaacatcctactataaattcctggatttctcaggaaatagggagtaaattc
tataattttaacgactggattttatcagaaaaacagccgatatttgttcaaaaaatggct
gaacaacttgatcagattgtaacaattttatcccctagacctgtttattatagagccttc
gatttacgagaagtagaacaatctgtctcaggattaacttatttttacccccaccagccc
cttaccaatgggggtaggggggatcagaagttatcctctcaggatgggattgatcgaggt
aattttctggcttcagaatctccatctttagaacgtctggctttatttgatttagaactt
aaagttttattagaattgtataaatctggggataaaaatattcatcttattttaccattt
attcgctctgtcgaggaatttttaatctataaacatcggattgaagcatcacaattaagt
cattatcctgagtttcaagtgtggattatggcggaagttccatcaattctatttttatta
cctgattacctgaaagcaggagttcaagggatttcaattggcaccaatgatctgacccaa
ttattatttggaattgatcgaaatcaaatgcaggtattcccaggtttatatgaaagcaat
ccggcttttaaaaaagcgataaaacagttaattgaaatggcaaaaaccgctaatattcct
tgttcaatttgtggagatgctcccgcattatatcccgaattaattgaagatttagtccgg
tggggaattacatcaatttccgttaatttagatgccattgaatctacctatatggcgatc
gccaaatcagaaaaacagattcccctagaaacctctcgccatcatctttag

KEGG   Planktothrix agardhii: NIES204_42340
Entry
NIES204_42340     CDS       T05658                                 

Gene name
ppsA
Definition
(GenBank) phosphoenolpyruvate synthase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00620  Pyruvate metabolism
pagh00680  Methane metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_42340 (ppsA)
   00620 Pyruvate metabolism
    NIES204_42340 (ppsA)
  09102 Energy metabolism
   00680 Methane metabolism
    NIES204_42340 (ppsA)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     NIES204_42340 (ppsA)
SSDB
Motif
Pfam: PPDK_N PEP-utilizers_C PEP-utilizers
Other DBs
NCBI-ProteinID: BBD56899
UniProt: A0A2Z6CKH5
LinkDB
Position
4671917..4674460
AA seq 847 aa
MVNTYATTETVNSEAKETAFVLWFDEVGISDIPSVGGKNASLGEMIRELASQGVNVPNGF
ATTAYAYRYFIESAGLEKKLRELFADLDVEDMPNLRQRGKQARSLILDTPFPPELEAAIT
SAYKKLCERYSTDGDFCNQFGEEYKEECKRYSNDVDVAVRSSATAEDLPDASFAGQQETY
LNVYGEEGVLESCHKCFASIFTDRAISYRTIKNFDHFNVALSVGVQKMVRSDLACSGVMF
SIDTETGFKNAALVTGAYGLGENVVQGTVNPDEYFVFKPTLLQGFRPILEKRLGSKELKM
VYDIGGSKLTKNISVSQSERDKYCINDDEILQLAKWACIIENHYSQVRGTYTPMDIEWAK
DGITGQLFIVQARPETVQSQKSASVLRNFKLLGTSKVLSRGRAVGEMIGQGKARVILDVH
KIDEFQAGEVLVTNKTDPDWEPIMKKSSAIVTNAGGRTCHAAIIAREMGIPAIVGCGDAT
SVIKNGQEITVSSSEGEEGRVYEGLVPFEIQETVLDNLPKTRTKILMNVGNPEEAFGLSS
IPCDGVGLARLEFIIANHIKAHPLALLKFDQLEDELAKREIAEMTKIYDHKPDFFVDKLA
HGIGMIAAAFYPNPVIVRMSDFKSNEYANLLGGRQFEPKEENPMIGWRGASRYYDPNYRE
AYGLECVALKRVRDEMGLTNVTPMIPFCRTPDEGRKVLAEMEKHGLKRGVNGLEVYVMCE
LPSNVIFADEFAAVFDGFSIGSNDLTQLTLGLDRDSALVAHIFDERNEAVRRMVTIAIKA
AKKYGRKIGICGQAPSDYPEFARFLVELGIDSISLNPDSVIKTILDIGKMEEAGTLLDEV
MDVAKAK
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggttaacacttatgcaacgactgaaacagtaaattcagaagcgaaagaaacagctttt
gtactgtggtttgatgaagtgggaatttctgatattccctcagtaggtgggaaaaacgca
tccttgggcgaaatgattcgagaactcgcttcccaaggtgtgaacgttccgaatggattt
gctaccactgcctatgcttatcgttattttattgagtctgcgggtttagagaaaaaacta
cgggaactatttgcagacctcgacgttgaagatatgccaaacctgcgacaacgcgggaaa
caagctcgttccttaattttagacactccgtttccaccagaattagaagccgcgattacc
agcgcctataaaaaactctgcgaacgctacagcaccgatggggatttttgtaaccaattt
ggcgaggaatataaagaagaatgcaaacgctattccaatgatgtagacgttgccgtgcgt
tcctccgctaccgccgaagacttacccgatgccagttttgccggacaacaggaaacctac
ttaaacgtttatggcgaagaaggagttttagaatcctgccataaatgctttgcctcgatt
ttcaccgaccgggcaatttcctatcgcacgattaaaaatttcgaccattttaacgtggct
ctgtccgtcggtgtgcaaaaaatggtacggtctgacctcgcctgttccggggtgatgttc
tccattgataccgaaaccggattcaaaaatgcagccttagtaactggagcctatggttta
ggagaaaacgtagttcaaggcacggttaaccccgatgaatattttgtgtttaaaccgacc
ttactgcaagggttccgtcctattttggaaaaacgcttaggcagtaaagaactgaagatg
gtctatgatatcggaggttctaaactaactaaaaacatctcagtttctcagtctgaacgg
gataaatactgtattaacgacgacgaaattttacaactggcgaagtgggcttgtattatt
gagaaccactattcgcaagtccggggtacttatactccgatggatattgaatgggccaaa
gatggaattaccggacaattatttatcgtccaggcccgtcctgaaaccgtgcaatcccag
aaatccgcttccgttctccgcaactttaaactgctcggaaccagtaaggttctatctcgc
ggtcgggccgtgggtgaaatgattggtcaagggaaagcgcgggtgattctggatgtgcat
aaaattgatgaattccaagcgggtgaagtgttagtcaccaataagactgaccccgactgg
gaacccatcatgaagaaatccagcgctatcgttaccaacgcgggcggacggacgtgccac
gcagcaattatcgcgcgggaaatgggcattcccgccattgtcggttgcggtgatgccacc
tcggtgattaaaaacggccaagaaattaccgtttcctcatctgaaggagaagaaggtcgg
gtttatgaggggttagttccctttgaaatacaagaaaccgttctcgataatctgcccaaa
acccggacaaaaattttaatgaacgtgggcaacccggaagaagccttcggtttgtcttcg
attccttgcgatggtgtgggtttagcgcggctggagtttattattgctaaccatattaaa
gcccaccccttagcgttgttgaaatttgaccaactcgaagatgagttagccaaacgggaa
atcgccgagatgacgaaaatctacgaccataaaccggacttcttcgtggataaactggcc
catggtatcgggatgattgccgcggccttctatccgaatccggtgattgtgcggatgtcc
gacttcaagagtaacgaatacgccaacctgttaggcggccgtcagtttgaacccaaggaa
gaaaacccgatgattggttggcgcggcgcctcccgttactacgaccccaactaccgcgaa
gcctacgggttagaatgtgtggccctgaaacgggttcgggacgaaatgggtttaacgaat
gtcaccccgatgattcccttctgtcgcacccccgatgaaggtcggaaagtgttagcagaa
atggaaaaacacggtctgaaacggggcgtcaatggtttggaagtttatgtgatgtgtgaa
cttcccagtaacgtgattttcgccgatgaatttgccgccgtgttcgatggattctcgatt
gggtctaatgatttaacccaattaacgttaggtttagaccgagattctgccttagttgct
catatttttgatgaacggaatgaagctgttcgtcggatggtgaccattgcgattaaagcg
gctaaaaaatatggtcgcaagattggaatttgtggtcaagcaccgagtgattatcctgag
tttgcccggttcttggtggaattgggaattgattcaattagtttgaatcctgactcggtg
attaaaacgattctggatattggcaaaatggaagaagctggcacgttattagatgaagtt
atggacgttgccaaagccaaataa

DBGET integrated database retrieval system