KEGG   Planktothrix agardhii: NIES204_30180
Entry
NIES204_30180     CDS       T05658                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00620  Pyruvate metabolism
pagh00680  Methane metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NIES204_30180 (ppc)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_30180 (ppc)
   00680 Methane metabolism
    NIES204_30180 (ppc)
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     NIES204_30180 (ppc)
SSDB
Motif
Pfam: PEPcase PEPcase_2
Other DBs
NCBI-ProteinID: BBD55701
UniProt: A0A2Z6CGJ2
LinkDB
Position
complement(3403948..3407046)
AA seq 1032 aa
MSSLLQSSEQAPNTVVSSNPPTTTSDLFLRNRLKIIEDVWESVLCQECGQQLVDLLHQLA
SMTSPEGQAEEFQGSDSLKLIEQLDINQAIRAARGFALYFQLINIVEQHYEQREQQLAYN
HGKGKAKSPVSPVKSMSTFDTRNQRFSDQEESPLPNVTNYSEQDRELATFHSLFPMLRQL
NVPAQKIQRLLDQLDVRMVFTAHPTEIVRHTIRTKQRRIATILEQLDQIDESFGGLRTEE
LGESSIMSELTEELHENLTEEIRLWWRTDELHQFKPTVLDEVDYSLHYFQEVIFDTIPQL
YKRLKHALNVSFPYLKLPKHDFCKFGSWVGSDRDGNPSVTPEVTWKTACYQRHVVLEKYI
EAVKRLNRLLSLSLHWSDVLPELLESLDRDQGQLPDIYDQTAIRYRQEPYRLKLSYVQKR
LENTRDRNWQMYNNAEMSRIRERLVPDHEASKLYRSGNDFLVELKMIQRNLEETGMNCQE
LENLICQVEVFGFSLARLDMRQESSIHCNALNEITNYLQVLPKPYTELSEAERCLWLATE
LQTRRPLIPAELPFSEKTCETITTFRVMRELQQEFEPEICQTYIISMSNEASDLLEVLLL
AKEAGLYDPATGIGNVIVVPLFETVEDLKRAPRVMTTLFELPLYRAMLAGGYEQYKLVSH
DPDLSLQEIMLGYSDSNKDSGFLSSNWEIHKAQKALQKVSESYKVGLRIFHGRGGSVGRG
GGPAYKAVLAQPGRSINGRIKITEQGEVLASKYSLPQLALFNLESVTTAAIQASLLHNGF
DEIDPWNQIMEELSMRSRAHYRALIYEEPDLPEFFHQVTPIQEISQLQISSRPARRSGDK
KKDISGLRAIPWVFSWTQSRFLLPSWYGVGTALQAFINEEPQENLKLLRYFYVKWPFFKV
LISKTEMTLAKVDMEIAHHYVRELSHPDDLERFEILFQQILAEYHLTVQLVQEITGHQQL
LEDDPVLQRSVQLRNATIIPLGLLQVALLKRLRQHGKSVASGVVHSRYSKGELLRGALLT
INGIAAGMRNTG
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgagttcactgctccaatcttccgaacaggctccaaatacggtcgtttcgtcaaacccg
ccaactaccacttcggatttatttttacgcaatcgtctcaagattattgaggatgtctgg
gagtccgttctctgtcaagagtgcggtcaacaactggtggatttactccatcagttagca
tccatgacctcaccggaaggacaggctgaagaatttcaaggatcggattccctcaagtta
atcgaacagcttgatattaaccaggctattcgtgcggccagagggtttgccttatatttt
caactgattaatatcgttgaacagcactatgaacaacgggaacaacagcttgcttataac
cacggaaaagggaaagcaaagtcacctgtctccccggtgaaatccatgtctactttcgat
actcggaatcaacgtttttccgatcaagaagaaagtccccttcctaatgtcaccaattac
agcgaacaggatcgggagttggctactttccattccctgtttccgatgttgcgacagtta
aatgttcccgcccaaaagatccaaaggttattagatcaactagatgtgcggatggtattt
acggctcacccgacggaaattgttcgccatacaattagaaccaaacagcgtcgcattgcc
actatcctagaacaacttgatcaaattgatgaaagttttggcggactcagaactgaggag
ctaggagaatcttccattatgtcggaattgacagaagaactccatgaaaacttgaccgaa
gaaattcggctgtggtggcgtaccgatgaactccaccaatttaagccaacggttttggat
gaggtagattattccctgcactactttcaggaagttatatttgacaccattcctcaactt
tataagcgcttaaaacacgctttaaatgtttcttttccctatctgaaattacctaaacat
gatttttgtaaattcggatcttgggtgggttcagatcgagacggaaatccatcggtaaca
ccggaagttacctggaaaactgcttgttatcagcgtcatgttgtcctagaaaaatatatt
gaagccgtcaaacgcctcaatcgtttattgagtttatccttacattggagtgatgttctt
cccgaattattagaatctttggatcgagatcaaggacaattacctgatatctatgatcaa
accgccattcgctatcgtcaagaaccctatcgtttaaaactttcttatgtccaaaaacgg
ttagaaaatactcgcgatcgcaattggcaaatgtacaataatgccgaaatgtctcgcatc
cgagagcgtctggttcctgaccacgaagccagtaaattataccgttctgggaatgatttc
ttggtggagttgaaaatgattcaacgcaacctagaggaaaccggaatgaactgtcaagaa
ctggaaaatctcatctgtcaggtggaggtttttgggtttagtttagcccggttagatatg
cgtcaagagtcttcaattcattgtaatgctctgaacgaaattactaactatttgcaagtc
ttacccaaaccctacaccgagctttcagaagccgaaagatgtctatggttagcaacagaa
ctccaaacccgtcgccccctaattccggcggaattaccgttttctgaaaaaacctgcgaa
accattaccacctttagggtaatgcgggaattacaacaggaatttgagccggaaatttgc
caaacctatattattagtatgagtaatgaagccagtgatttactggaagtattactgtta
gcaaaagaagccggactttatgatccagccaccggaattgggaatgttattgttgttcct
ctgtttgaaacggtagaagatctcaaacgtgctccccgggtgatgacaactctgtttgaa
ttacctttatatcgggcaatgttagccggaggttatgaacaatataaacttgtgagtcac
gatcccgatctatctctacaagagattatgttaggctattccgatagtaataaagattcg
ggtttcttgagcagtaactgggaaattcataaagcccaaaaagccttgcagaaagtgtct
gaatcctataaagtcggtctgcgaatcttccacggacgcgggggttcggtgggtcgaggc
ggtggcccagcctacaaagcggttttggctcaaccgggccgcagtattaatggccggatt
aaaattaccgaacagggggaagtcctggcgtctaaatattctctcccacagttggcttta
tttaacctcgaaagcgtgactaccgcagccatccaagccagtcttctccataacggtttt
gatgagattgatccctggaatcaaattatggaggagttgtcaatgcgatcgcgggcgcac
tatcgggctttaatttatgaagaacctgatttacccgaattcttccatcaagttaccccg
atccaagaaattagccaactacaaatcagttctcgccccgcccgtcgcagtggtgataag
aaaaaggatatttctggtttaagggcgattccctgggtatttagctggactcagagccgt
tttttactgccttcttggtatggtgtgggaaccgctttacaggcatttatcaacgaggaa
ccccaggaaaatctgaaactcctgcggtatttctacgttaaatggccattctttaaagtg
ttgatttccaagacggaaatgaccttagctaaagtagatatggaaatcgcccatcactac
gttcgggagttaagtcatcccgatgatctcgaacggtttgagatattattccaacaaatc
ctcgccgaataccatctcaccgttcagttagtccaagaaattaccggacatcaacaacta
ttagaagatgatccggttctacaacgttcggtgcagttacgcaatgccacgattattcct
ttgggtttattacaagtggctttgttaaaacggttacgtcaacacggaaaatccgtggct
tcgggtgtcgtccattcccgttatagcaagggtgaattactccgaggcgccctattaacc
attaacggtattgccgccggaatgcgaaatacaggctga

DBGET integrated database retrieval system