KEGG   Planktothrix agardhii: NIES204_31350
Entry
NIES204_31350     CDS       T05658                                 

Definition
(GenBank) hypothetical protein
  KO
K15918  D-glycerate 3-kinase [EC:2.7.1.31]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00260  Glycine, serine and threonine metabolism
pagh00561  Glycerolipid metabolism
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_31350
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    NIES204_31350
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NIES204_31350
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.31  glycerate 3-kinase
     NIES204_31350
SSDB
Motif
Pfam: Mg_chelatase
Other DBs
NCBI-ProteinID: BBD55817
UniProt: A0A2Z6CH19
LinkDB
Position
3533095..3534129
AA seq 344 aa
MIEILKAWKTGQKPQPTDLEVLEEWELSDHQRSTAFGITPENVMVNIEARSRLFCQLQQK
KIEFPLLFEQLETLWKFWLPLAAQLAEHRQRLGRPLVQGILGGQGTGKTTLGKVLTYILS
LFHYDTLSLSLDDLYKTYSERQQLQKADPRLIWRGPPGTHDLELGIQVLDQLRQPLPDQT
IAIPRFDKSLWQGAGDRISPEFVTGIDIILFEGWFVGCRPINPQLFDSAPVPIITPSDKK
FARDMNKQLNGYIYLWEKLDRLLILNPVDYRLSKQWRIQAEHDMIKTGKSGMTDVEISQF
VDYFWKALHPELFINSLMENPEFVDLIIEINPDHSIGNVYQVNL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgattgaaattctcaaggcttggaagactggacaaaagccccagcccacagatttagaa
gttttagaagaatgggaactgtctgatcatcaacgttcaactgcttttggaatcacaccg
gaaaatgttatggtgaacatagaagcccgatcccgtctattctgtcaacttcaacagaaa
aagattgagtttcctctgttatttgaacagctagaaaccctgtggaaattttggctacct
ttagcggcccaactggctgaacatcgtcaacgcttgggtcgtcctctggttcaaggaata
ttaggagggcaaggcacaggaaaaacaactctagggaaagtcttaacttatattttgtct
ctgttccactatgacacacttagcttgtccttagatgatctctataaaacttattcggaa
cgtcaacaattacaaaaagctgatccgcgtttaatttggcgagggccacccggaacccac
gatcttgaattaggaatccaggttttagatcaattgcgtcaacctttgcctgatcaaacc
attgccattcctcggtttgataagtcattatggcagggggcaggcgatcgcatttcaccg
gaattcgtgaccggaattgatattattttatttgaaggttggtttgtaggctgtagacca
attaacccccaactctttgattctgccccagttccgattattactccctcggataaaaaa
tttgctagggacatgaataaacagttaaatgggtatatttatttatgggaaaaattagat
cggttgctaattttaaatcctgtagattatcgcctatcaaaacagtggcgaatccaagcc
gaacatgatatgattaaaacaggaaaatcgggaatgactgatgtagaaattagtcaattt
gttgattatttctggaaagccttacatcccgaattgtttataaactccttgatggaaaat
cccgaatttgtggatttaattatagagattaatcccgatcattctatcgggaatgtttat
caggttaatctatga

DBGET integrated database retrieval system