KEGG   Planktothrix agardhii: NIES204_31570
Entry
NIES204_31570     CDS       T05658                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00020  Citrate cycle (TCA cycle)
pagh00640  Propanoate metabolism
pagh00660  C5-Branched dibasic acid metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NIES204_31570 (sucC)
   00640 Propanoate metabolism
    NIES204_31570 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NIES204_31570 (sucC)
Enzymes [BR:pagh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NIES204_31570 (sucC)
SSDB
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 Ligase_CoA CPSase_L_D2
Other DBs
NCBI-ProteinID: BBD55839
UniProt: A0A2Z6CHG7
LinkDB
Position
complement(3553668..3554822)
AA seq 384 aa
MDLLEYQAKTLFREMGIPVLPSQSINNAQDLKGLKIPYPVVLKSQVRAGGRGKAGGIRFA
ENTIDAVAAAQMIFNLPIRGECPQVLLAEAKYDADRELYLAVTLDSGSRRPVLLGSQQGG
VNVEATLSKIQQVIVDQDFSPFYARRLILKMGLKGDLILLVSAIVEKMYRLFVQKDLDLV
EINPLGISPTGEVMALDGKVIANDGALGRHEDLITLLKAQQKCSSLSLPIISDQLFHPEL
NLVELQGNIGILCNGAGLTMATLDLVMQSSGKPANFLNLGGADHYEITDNFRQRLYQGID
RITQSKQVKVVIINLWVQPIIRSSLLVEIAGYLKRKARTSNLPKFVLMLAGIKPESDIEQ
FTDLPVNLFDRLDLAVTAAINLAK
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggatttgctagagtatcaagctaaaaccttatttcgtgagatggggattccggtttta
ccctcacaaagcattaacaatgctcaagatttaaagggtttaaaaattccctatccggtg
gtgttgaaatcccaagtccgggctggaggtaggggaaaagccggaggaattcgctttgcg
gaaaataccattgatgcggttgctgcggctcaaatgatttttaatttaccgattcggggt
gaatgtccccaagtcctgttagcagaagccaaatatgatgcggatcgggaattatactta
gctgtcaccttggattccgggtcacgacgtccggtattattgggatcgcaacagggcggg
gtgaatgtggaagcaaccctttccaaaattcagcaagtcattgttgaccaagatttttct
cctttttatgctagaagattaattctaaaaatgggattaaagggagatttaattctcttg
gtcagtgccattgtggaaaaaatgtatcgtctatttgtccagaaagatttggatctcgta
gaaattaatcccttggggattagtcccacgggagaagtgatggcattggatgggaaagta
attgcgaatgatggagcattaggacgccatgaagacttaattactttacttaaagctcaa
caaaaatgtagttctctctccctaccgataatttccgatcaattgtttcaccctgaactg
aatttagtcgaattacaaggtaatattgggattttatgcaatggtgcaggtttaacgatg
gcaactttagatttagtcatgcaatcatcgggaaaacctgctaatttcttaaatctaggt
ggggcagatcactatgaaattacagacaattttcgccaacgtttatatcaaggaattgat
cgaattacccaatctaaacaagttaaggttgtgattattaatctttgggttcaaccgatt
attcgttcttctttattagtggaaattgccggatatttgaaacgaaaagctagaaccagt
aatttacctaaatttgttctgatgttggctggaattaaacccgaatcagatatagaacag
tttactgatttacctgtaaatttatttgatcggttggatttagctgtgactgcggctatt
aatttagccaaatag

DBGET integrated database retrieval system