KEGG   Planktothrix agardhii: NIES204_31890
Entry
NIES204_31890     CDS       T05658                                 

Definition
(GenBank) alcohol dehydrogenase/acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00071  Fatty acid degradation
pagh00350  Tyrosine metabolism
pagh00620  Pyruvate metabolism
pagh00625  Chloroalkane and chloroalkene degradation
pagh00626  Naphthalene degradation
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_31890
   00620 Pyruvate metabolism
    NIES204_31890
   00650 Butanoate metabolism
    NIES204_31890
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NIES204_31890
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NIES204_31890
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NIES204_31890
   00626 Naphthalene degradation
    NIES204_31890
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NIES204_31890
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     NIES204_31890
SSDB
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2
Other DBs
NCBI-ProteinID: BBD55870
UniProt: A0A2Z6CHT8
LinkDB
Position
3597654..3600320
AA seq 888 aa
MEKVTNIDQLESLIQRVKVAEQKYATYTQEQVDYIFKKAALAANAARIPLAKMAVEETGM
GVVEDKVIKNHFASEIIYNKYKHEKTCGVIEEDKSFGFQKISEPVGILAGIVPTTNPTST
AIFKALIALKTRNGIIFSPHPRAKNCTTAAAKIVLDAAVAAGAPEDIIGWIDAPTVPLSQ
ALMQHPDIKLILATGGPGMVRAAYSSGNPSLGVGAGNTPALIDDTAHIKMAVSSIIISKT
FDNGMICASEQSVIVVDSVYEEVKKEFTLRGAYFLTPEERERMAKVIFVNGHLNGEIVGQ
PVQKLGELAGINLSEETRVIIGEGIEVDENDPFSHEKLSPILAMYRAKDFEDAVVKADTL
VQLGGRGHTASLYTSPNNIDHIKRFENTVQTARVLINTPSSQGAIGDIYNFRLDPSLTLG
CGSWGGNSISENVEPRHLLNIKTVAERRENMLWFRIPPKVYFKYGSLPVAIRELAGKERA
FIVTDKPLFDLGITRSLEGVLEEIGIKYDVFYDVEPDPSLDTVQRGLTLMNTFKPDVIIA
IGGGSPMDAAKIMWLMYEHPDIEFEGLAMRFMDIRKRVYELPPLGKKAMLVAIPTTSGTG
SEVTPFAVVTDRRTNIKYPLADYALTPNMAIVDPELVLNMPKSLTSFGGVDALTHALESY
VSVLASEYTNGLSLEAIRLIFKYLPSSYNNGANDPKAREKMHYASTMAGMAFANGFLGIC
HSLAHQLGGTFHIPHGLANALMISYVIRYNATDVPFKQATFSQYKYPNAKWRYSRIADYL
RLGGDTEDQKIDHLILAIEELKRQVGIPASIKEVLKDISEAEFLAKLDEVADQAFDDQCT
GANPRYPLIKDLKQLLIDAYYGHPLVSNDYNGDRIFPVFEPQPTMIGG
NT seq 2667 nt   +upstreamnt  +downstreamnt
atggaaaaagtcacaaatattgatcaacttgaatccctaatccaacgggtcaaggttgca
gaacaaaagtatgcaacctatacccaggaacaggtagactatatttttaaaaaagcggct
ctagcggcaaatgctgcccggattcctttagcaaaaatggccgtagaagaaaccggaatg
ggggttgtagaggataaagtgattaaaaaccactttgcttcagaaattatttacaacaaa
tataaacatgaaaaaacctgtggtgtcatcgaagaagacaaatcctttgggtttcaaaaa
atctccgaacccgtggggattttagccggaattgttccgacaacaaacccaacatcaacg
gctatttttaaagccctaattgccttgaaaactcgcaacgggattattttttctccccat
ccccgtgccaaaaattgtaccaccgccgctgccaaaattgtcttagatgcagccgtcgcc
gccggagccccagaagacattatcggctggattgatgcacccaccgtacctctgtcccaa
gccctaatgcagcacccggatattaagctaattttagccactggagggccaggaatggta
cgggcagcctattcttccggtaatccttccctgggggtcggggcggggaataccccggct
ttaattgacgataccgcccatattaaaatggccgtttcctcaattattattagtaaaacc
ttcgacaatggcatgatttgtgctagtgaacaatcggtaattgtggttgattctgtttac
gaagaagtcaagaaagaatttaccctacgcggcgcctatttcctaaccccagaagaacgg
gaacggatggcaaaggttatttttgtgaacggacatttgaatggggaaattgtcggtcaa
cccgtgcaaaaattaggggaattagccggaattaatctctcggaagaaaccagggtaatt
attggagaagggatagaagttgatgaaaatgatcccttttcccatgaaaaactttctccg
attttagccatgtatcgggctaaggatttcgaggatgcggtggtaaaagccgatacttta
gtacagttagggggacggggacacaccgcctctttatacacttctcccaacaatatcgac
catattaaacggtttgaaaataccgttcaaaccgcccgggttttaattaatactccgtct
tctcaaggagctattggtgatatttataacttccgtcttgacccttctttaaccttggga
tgtggcagttggggaggcaattccatcagcgaaaacgtcgaacctcggcatttattaaac
attaaaaccgtcgccgaacgtcgagaaaatatgctctggtttcggattcctcccaaagta
tatttcaaatatggatctttacccgttgctattcgagaattagctggaaaagaacgggct
tttattgtcaccgataaacccctatttgatttaggaattacccgttccctcgaaggagtt
ttagaggaaattggaataaaatatgatgtgttctacgatgttgaacccgacccttcttta
gatacggtacaacggggattaactttaatgaatacgtttaaacccgatgtaattattgcc
attggtgggggttctcccatggatgcagctaaaattatgtggctgatgtatgaacatcct
gatatcgaatttgaagggttagcaatgcggtttatggatatccgtaaacgggtttatgaa
ttgccacctttgggcaaaaaagcgatgttagttgcgattcctactacctctggaaccggg
tcagaagtaacgccttttgccgttgtcaccgaccgccgcactaatattaaatatccttta
gccgactatgccttaaccccaaatatggcaattgttgacccggaattggtgttaaatatg
cccaaaagtttaacctcttttgggggcgttgatgccctaacccatgccttagaatcctat
gtttcggtattagcttcggaatataccaatgggttatccttagaggcaattcggttaatt
tttaaatacctgccgagttcctataataatggagcaaatgatcccaaagctcgggaaaaa
atgcactatgcttctactatggcggggatggcatttgctaatggattcctcggaatttgt
cactccttagcccatcaattaggtgggactttccacattccccacgggttagcaaatgcc
ttaatgattagttacgttattcgttataatgctaccgatgttccgtttaaacaagccact
ttctcccagtataaatatccgaatgctaaatggcgctattctcggattgcggattatctg
cgcttagggggagacaccgaagatcaaaaaatcgatcatttgattttagccatcgaagaa
ttaaagcgccaagtgggaattccggcttcaattaaggaggttttaaaagatatcagtgaa
gcggaatttctggctaaattagatgaagttgctgaccaagcttttgatgatcaatgtacc
ggagccaatccccgttatcctttaattaaggacttgaaacaactgttaattgatgcctat
tatggtcatcctttagtttctaatgattacaatggcgatcgcattttccccgtctttgaa
ccccaaccaactatgattggcggttaa

DBGET integrated database retrieval system