KEGG   Planktothrix agardhii: NIES204_32340
Entry
NIES204_32340     CDS       T05658                                 

Gene name
rbcL
Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_32340 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_32340 (rbcL)
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES204_32340 (rbcL)
SSDB
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Other DBs
NCBI-ProteinID: BBD55915
UniProt: A0A2Z6CHS4
LinkDB
Position
3634188..3635618
AA seq 476 aa
MSYSQTQTKSKSGYKAGVQDYKLTYYTPDYTPKDTDVLAAFRMSPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYEVEPVPGEDNQYICYVAYPLDLFEEGSVTNLLTS
LVGNVFGFKALRSLRLEDLRIPIAYLKTFQGPPHGITVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYEVLRGGLDFTKDDENINSQPFMRWRDRFLFVQEAIEKAQAETGEIKGHY
LNVTAPTCEEMMERAEFAKEIKTPIIMHDYLTGGFTANTSLAKWCRRNGILLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHLHSGTVVGKLEGEKGITMGFVDLMREDHVEVDRS
RGIYFTQDWASMPGVMPVASGGIHVWHMPALVEIFGDDSCLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRNLMREGGDVIREACKWSPELAVACELWKEIKFEFESMDTV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgtcttactctcaaacacaaaccaagtccaagtctggctataaagctggtgtacaggac
tataaactgacctattacacgcctgactatacaccaaaagatacagacgttctggctgcc
tttcggatgagtcctcaacctggagtccccccggaagaagctggtgctgctgttgctgct
gaatcctcgactggaacttggacaacggtgtggacggacttactgactgacctcgaccgc
tataaaggtcgttgctatgaagtcgaacccgttcccggtgaagataaccaatatatctgc
tacgttgcctatcctctggatctgtttgaagaaggttccgttaccaacttactgacatct
ttagtcggtaacgtatttggtttcaaagccctgcggtcactgcgtttagaagatttacgc
atccccatcgcttacctgaaaaccttccaaggccctcctcacgggattaccgttgagcgc
gataaattaaacaaatacggtcgtcctctgctcggttgtacgattaaacccaaactcggt
ctgtctgcgaaaaactacggtcgcgccgtttatgaagttctgcgcggtggtttagacttc
accaaagacgacgaaaacatcaactcccagcccttcatgcgctggcgcgatcgcttcctg
ttcgttcaagaagccatcgaaaaagctcaagcagaaaccggggaaatcaaaggccactac
ttaaacgtgaccgcccccacctgcgaagaaatgatggaacgggctgaattcgctaaagaa
atcaaaaccccgatcatcatgcacgactaccttacaggtggtttcactgctaataccagc
ttggccaaatggtgtcgtcgcaatggcattctgctgcacattcaccgtgcgatgcacgct
gtgattgaccgtcagaaaaatcacgggattcacttccgtgtgttagccaaatgcttacgg
atgtctggtggtgaccacctgcactcgggaaccgttgtgggtaaactcgaaggggaaaaa
ggcatcaccatgggcttcgttgacctgatgcgtgaagatcacgttgaggttgatcgctct
cgtgggatctacttcacccaagattgggcttctatgcctggtgttatgcccgtggcttcc
ggtgggattcacgtttggcatatgcccgccctggtggaaatcttcggcgatgactcttgc
ttacagttcggtggtggaaccctcggacatccctggggtaatgctcctggtgctaccgct
aaccgtgtggccctcgaagcttgtgttcaagcgcgtaacgaaggtcgtaacctgatgcgt
gaaggcggcgacgtcatccgtgaagcttgcaaatggtctcctgaactggccgttgcttgc
gaactctggaaagaaatcaagtttgagttcgagtcaatggataccgtctaa

KEGG   Planktothrix agardhii: NIES204_32360
Entry
NIES204_32360     CDS       T05658                                 

Gene name
rbcS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00630  Glyoxylate and dicarboxylate metabolism
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00165  Reductive pentose phosphate cycle (Calvin cycle)
pagh_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
pagh_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NIES204_32360 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_32360 (rbcS)
Enzymes [BR:pagh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     NIES204_32360 (rbcS)
SSDB
Motif
Pfam: RuBisCO_small
Other DBs
NCBI-ProteinID: BBD55917
UniProt: A0A2Z6CHB2
LinkDB
Position
3636218..3636553
AA seq 111 aa
MRTLPKERRFETLSYLPPLTDAQIVKQVQYILDQGYIPGVEFSESSEPTQHYWTLWKLPL
FNATTSQEVLNEVQACRQENSKSYIRVMGFDNVKQCQVLSFIVHKPSSSLY
NT seq 336 nt   +upstreamnt  +downstreamnt
atgcggacattaccaaaagaacgtcgttttgaaacgttatcctatcttccccccttgacc
gatgctcaaatcgtcaagcaagtccaatatattctggatcaaggatatatccccggtgtg
gagtttagcgaatcttccgaacccacccaacattattggacgctgtggaaactgccttta
ttcaatgccactacttctcaagaagttttgaatgaagttcaagcttgccgccaagaaaat
tctaaatcctatatccgtgtgatgggttttgataacgtgaagcaatgccaagtgttaagc
ttcatcgtccacaaacccagtagctctttatactaa

DBGET integrated database retrieval system