KEGG   Planktothrix agardhii: NIES204_34010
Entry
NIES204_34010     CDS       T05658                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00280  Valine, leucine and isoleucine degradation
pagh00410  beta-Alanine metabolism
pagh00562  Inositol phosphate metabolism
pagh00640  Propanoate metabolism
pagh01100  Metabolic pathways
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NIES204_34010
   00562 Inositol phosphate metabolism
    NIES204_34010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NIES204_34010
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NIES204_34010
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     NIES204_34010
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     NIES204_34010
SSDB
Motif
Pfam: Aldedh ATP-synt_E_2
Other DBs
NCBI-ProteinID: BBD56080
UniProt: A0A2Z6CIF6
LinkDB
Position
complement(3811569..3813047)
AA seq 492 aa
MKTVKILPNYINGKWDLSQATETLEIINPATLEVLAKVPLSPAKELDQVAEIAQKSFNSW
RQTPVTERIRYLFKLRELLEQNQQDLAETITLECGKTLAESLGELQRAIENVEVACGVPS
LIQGYNSEDIARGIDEMMIRQPLGVVAIISPFNFPGMIPFWFFPYAIACGNTCIIKPSEK
VPLTMQKVFALIDQLGLPPGVINLINGGKETVDAILENPQIKAISFVGSTAVAKYVYSRA
AANGKRAQCQGGAKNPAIILPDADLEMTTKIIADSAFGCAGQRCLATSIAITIGQAKQSF
TDAIASAAETRIVGYGLNKNVQMGTVISAESKTRIEGLIQQGKQEGGKILIDGRNPKISG
YEQGYFIRPTILQDINPQGEIARTEIFGPVLSLIHLNTMEEAIAFINQSEYGNMACLFTR
SGAAARQFRYQVQAGNIGINIGVAAPMAFFPFSGWKNSFFGDLHGQGQQAVEFFTQTKVV
VERWLSDWSRQF
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaaaacagttaaaattttacctaactatattaatggaaaatgggatttatcccaggca
acagaaaccttagagatcattaacccggcgaccttagaagtattagcaaaagtccctctt
tctcctgcaaaggaactggatcaggtggcagaaatcgcccaaaaatcctttaattcatgg
cgacaaaccccagttacagagcgtattcgttatctgtttaaactcagagaattacttgaa
caaaatcaacaggatttagcggaaacaattaccttagaatgtggaaaaaccctggctgaa
tccctaggagaattacaacgagcgattgaaaatgtggaagtagcttgtggtgttcctagc
ttaattcaaggttacaattccgaagatattgctaggggaattgatgaaatgatgattcgt
caacctttaggagttgtggcgattatttccccgtttaattttccggggatgattccgttt
tggttttttccttatgcgatcgcctgtggcaatacttgtattattaaaccctcggaaaaa
gtacctttaaccatgcaaaaggtttttgctttaattgatcaattaggactacccccagga
gtgattaatttaatcaatggaggcaaagaaaccgttgatgctattttagaaaatccccag
attaaagcgattagttttgtcggttccacggccgttgctaaatatgtttatagtcgggct
gctgctaatggcaaacgggcacaatgtcagggcggggcaaaaaatccggcgattatttta
cccgatgctgatttagaaatgaccacaaaaattattgctgatagtgcctttggttgtgcc
ggacaacgatgtttagccacatcaattgcgattactattggtcaagctaaacagagtttt
accgatgcgatcgcctcggctgcggaaactcgaattgttggttatggattaaataaaaat
gtccaaatgggaacggttatttctgctgaaagtaaaactcgaattgaaggattaattcaa
cagggaaaacaggaaggaggcaaaattttaattgatggcagaaatcctaaaatttccggc
tatgaacagggttattttatccgcccgactattttacaagatattaacccccagggagaa
attgcccgcaccgaaatttttggcccggtattaagtttaattcatctaaatacaatggaa
gaagcgatcgcatttattaatcaaagtgaatacggcaatatggcctgtttatttactcgc
agtggggcggcggcgcgacagtttcggtatcaagttcaggcgggaaatattgggattaat
attggtgttgccgcaccgatggcattctttccttttagtggttggaaaaatagttttttt
ggcgatttacacggccaaggacagcaggcggttgagttttttacccaaacaaaagttgtg
gttgaaaggtggttatctgactggtcacgacaattttaa

DBGET integrated database retrieval system