KEGG   Planktothrix agardhii: NIES204_34250
Entry
NIES204_34250     CDS       T05658                                 

Gene name
folD
Definition
(GenBank) bifunctional protein FolD protein
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00670  One carbon pool by folate
pagh01100  Metabolic pathways
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NIES204_34250 (folD)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     NIES204_34250 (folD)
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     NIES204_34250 (folD)
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Other DBs
NCBI-ProteinID: BBD56103
UniProt: A0A2Z6CJN8
LinkDB
Position
3833630..3834493
AA seq 287 aa
MDNLLDGKSTAKKIQAQLQEQVEIWQAKVGRPPGLAVIMVGENPASAVYVRNKEQACAKV
GITSFGQHFPAETSQEKLTSIIHELNQNEQVDGILVQLPLPANLDSVGLLYEIDPNKDAD
GLHPENLGRLARGEKGLRSCTPAGVMRLFEEYNIELKGKHAVVLGRSILVGKPMALMLLE
ADCTVTIAHSKTQDLAKVSRDADIVVAAIGRPQMITADFVKPGAIVIDVGINKITDNNGK
SRLVGDVDFDSVQPIAQYITPVPGGIGPMTVAMLLQNTFWSYLEKFQ
NT seq 864 nt   +upstreamnt  +downstreamnt
atggataatctattagacggtaaatctacagccaaaaagattcaagcccaactacaagaa
caggtagaaatatggcaagctaaagttggacgcccgcccggtttagcggtgattatggta
ggagagaatccggccagtgcggtgtatgttcggaataaagaacaggcttgtgctaaggtt
ggcatcacctcttttggtcaacatttccccgcagaaactagccaagaaaaacttaccagt
attatccatgaactgaaccaaaatgaacaagtggatggaattttagttcagttacccctt
cctgctaatttggactccgttgggttattatatgaaattgatccgaataaagacgccgat
ggtttgcacccggaaaatttaggccggttagccaggggagaaaaaggcctaagaagttgt
acccccgccggagttatgcgactatttgaggaatataatattgagctaaaaggaaaacac
gccgttgttttaggtcgcagtattttagtcggaaaaccgatggctttgatgttattagaa
gctgattgtaccgtaactattgcccattctaaaactcaagatttagctaaagttagccgg
gatgcggatattgtggtggcggctatcggacgtccgcaaatgattacggcggattttgtt
aaacccggcgctattgtgattgatgtcggaattaataaaattacggataataatggcaaa
tctcgcctagtcggggatgtagatttcgacagtgttcaacccatcgcccaatatattacc
ccagttccggggggtattggcccgatgaccgtggcgatgttattacaaaataccttctgg
agttatttggaaaaatttcagtag

DBGET integrated database retrieval system