KEGG   Planktothrix agardhii: NIES204_36740
Entry
NIES204_36740     CDS       T05658                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00053  Ascorbate and aldarate metabolism
pagh00071  Fatty acid degradation
pagh00280  Valine, leucine and isoleucine degradation
pagh00310  Lysine degradation
pagh00330  Arginine and proline metabolism
pagh00340  Histidine metabolism
pagh00380  Tryptophan metabolism
pagh00410  beta-Alanine metabolism
pagh00561  Glycerolipid metabolism
pagh00620  Pyruvate metabolism
pagh00625  Chloroalkane and chloroalkene degradation
pagh00770  Pantothenate and CoA biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_36740
   00053 Ascorbate and aldarate metabolism
    NIES204_36740
   00620 Pyruvate metabolism
    NIES204_36740
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NIES204_36740
   00561 Glycerolipid metabolism
    NIES204_36740
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    NIES204_36740
   00310 Lysine degradation
    NIES204_36740
   00330 Arginine and proline metabolism
    NIES204_36740
   00340 Histidine metabolism
    NIES204_36740
   00380 Tryptophan metabolism
    NIES204_36740
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NIES204_36740
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NIES204_36740
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    NIES204_36740
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NIES204_36740
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     NIES204_36740
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BBD56347
UniProt: A0A2Z6CII6
LinkDB
Position
4078745..4080121
AA seq 458 aa
MTEKTPIQGLIGQQRDFFATGQTQDIQFRLTQLQGLKQAIAFHETAIINGIKADLCRPDL
ESCFEFSPVAELNYAIKHLKSWVKPQKIPASLGQLPASTFIYPQPLGIILIIGPWNYPFQ
LLISPLIGAIAAGNCAILKPSEIAVNTSKIISDIISKTFNSEYIAVVEGGVETSQELLAE
KFDHIFFTGGQKVGQIVMEAAAKHLTPVTLELGGKSPCIVEDDIQLDYTAKRIIWGKLIN
AGQTCIAPDYLLVNCLIKSELIIALQKWIKTFLGDNPETSPDYSRIINHFHFNRLQQFLK
AGNIITGGKTNPETKYIAPTLIDNISWDDLIMQEEIFGPILPILEYQDLGEAIAKINSRP
KPLALYLFSNDKNKQNRILQETSSGTLCFNDTVLQIGGKSLPFGGVGESGIGSYHGKTTF
DQFSHYRSVLKQTFLLDLPLRYPPYKGKEWLIKKILMQ
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgactgaaaaaacgccaattcagggtttaattgggcaacagcgagacttttttgccact
ggacaaacccaggatatccagtttcgccttacccaacttcagggtttgaaacaggcgatc
gcattccatgaaacagccattattaatgggataaaagccgatttatgccgtcctgacctg
gaatcatgttttgagttttcccccgttgctgaactcaattatgccattaaacatctcaaa
tcttgggttaaaccccaaaaaattcccgcctctttaggtcaacttcccgcctcaacattt
atttatcctcaacctttaggaattatcctaattataggcccttggaattatccctttcaa
ctattgatttctcctttaattggagcgatcgcggcgggcaattgtgcaattttaaaacct
tcggaaattgctgttaatacctctaaaattattagtgatattatcagcaaaacctttaat
tctgaatatattgccgtggttgaaggcggagtcgaaaccagtcaagaattattggccgaa
aagttcgatcatattttctttaccggggggcaaaaagtcggtcaaattgtcatggaagcc
gcagctaaacatttaaccccagttactttagaattaggaggaaaaagtccctgtattgtc
gaggatgatattcaattagattataccgcaaaacggattatttggggtaaattaattaat
gcgggtcaaacttgtatcgcccccgattatttattagtgaattgtctaataaaatcggaa
ttaattatcgcgttgcaaaaatggattaaaacttttttgggcgataatcccgaaaccagt
cccgactattcccggattattaatcactttcattttaacagattacagcaatttttaaaa
gcgggcaatattatcactggaggcaaaaccaacccagaaacaaaatatattgctcccact
ttaattgataatatttcctgggatgatttaattatgcaggaggaaatttttgggccgatt
ttacctattttagaatatcaggatttaggagaagcgatcgcaaaaatcaacagtcgtccc
aaacctttagcattatatttattttctaacgataaaaacaaacaaaaccgaatattacaa
gaaacctcatcaggaaccctctgttttaatgataccgtactgcaaattggggggaaatct
ttaccctttggcggtgttggagaaagtgggataggaagttaccatggaaaaaccaccttt
gatcaattttcccattatcgcagtgtattaaaacaaacatttttattagatttaccccta
cgttatccaccctataaaggcaaagaatggttaataaaaaaaattctaatgcaataa

DBGET integrated database retrieval system