KEGG   Planktothrix agardhii: NIES204_36810
Entry
NIES204_36810     CDS       T05658                                 

Gene name
nifJ
Definition
(GenBank) pyruvate flavodoxin oxidoreductase
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00010  Glycolysis / Gluconeogenesis
pagh00020  Citrate cycle (TCA cycle)
pagh00620  Pyruvate metabolism
pagh00650  Butanoate metabolism
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NIES204_36810 (nifJ)
   00020 Citrate cycle (TCA cycle)
    NIES204_36810 (nifJ)
   00620 Pyruvate metabolism
    NIES204_36810 (nifJ)
   00650 Butanoate metabolism
    NIES204_36810 (nifJ)
Enzymes [BR:pagh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NIES204_36810 (nifJ)
    1.2.7.-  
     NIES204_36810 (nifJ)
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4_16 Fer4_10 Fer4_7 TPP_enzyme_C Fer4 Fer4_2 Fer4_9 Fer4_6 Fer4_21 Fer4_4 Fer4_8 Fer4_17 Transketolase_C Fer4_13 Fer4_22 Fer4_18
Other DBs
NCBI-ProteinID: BBD56354
UniProt: A0A2Z6CJ42
LinkDB
Position
complement(4088271..4091915)
AA seq 1214 aa
MNTKNYATLDGNEAVARVAYRLSEVIAIYPITPSSPMGEWADAWASVGDKNLWGTVPAVV
EMQSEGGAAGAVHGALQAGSLTTTFTASQGLMLMLPNLYKIAGELTCAVIQVAARSLAAQ
GLSIFGDHSDVMAARATGFALLCSASVQEAQDMALIAQASTLESRIPFIHFFDGFRTSHE
VQKIELLEDSDIRELIDDKYVYEHRNRALTPDRPVLRGTAQNPDVYFQGRETVNIFYDQT
PEIVQRAMDKLGQLTGRNYKLFEYHGAPDAERVIILMGSGCETVHETVDYLNAQGEKLGV
LKVRLYRPWDGEQLIAALPETVKAIAVLDRTKEPGSSGEPLYLDVVTAVQEVMLGDNDTL
KAKIKNLKALVGGRYGLSSKEFNPAMVKSVFENLAQTKPKNHFTIGINDDVSHTSLEYDP
SFSTEPDNVVRAMFYGLGADGTVGANKNSIKIIGEETDNYAQGYFVYDSKKSGAVTVSHL
RFGPQPIRSIYLISKANFIGCHQWTFIERLDVLQCAMEGSTFLLNSPYGPDQVWEYLPLE
IQEDIVRKNLKFYVIDANKVARDTGMGNRINTIMQVCFFALAKVLPREEAIAQIKKAIEK
TYGKKGAEIVRLNLKAVDETLEHLYEVNVAQANSALRRAEPVAVGAPTFVKEVEGMMIAG
RGDDLPVSKLPCDGTYPTGTSKWEKRNVAQDIPVWDADVCIQCGKCVMVCPHATIRGKAY
DEAALENAPASFKFTNVKDKAFTGEKFTIQVAPEDCTGCGICVDVCPAKNKSMPSRKAIN
MEPQLPLREQEATNWDFFLGIPNPDRLKLRPDLIRQQQWQEPLFEFSGACGGCGETPYIK
LVTQLFGDRMIVANATGCSSIYGGNLPTTPWTTNADGRGPAWSNSLFEDNAEFGLGFRMS
IDKHAGFALELLHKLGGEVGDNLVTQITDNAQKSEADIWEQRQRVVQLKEKLQGLNSPDA
QQLLSLADYLVKKSVWIIGGDGWAYDIGYGGLDHVIASGRNVNILVLDTEVYSNTGGQSS
KATPRGAVAKFAAGGKPSAKKDLGLIAMTYGNVYVASVAMGAKDEHTLKAFLEAEAYDGP
SIIIAYSHCIAHGINMTTAMTHQKDLVESGRWLLYRYNPDLKEAGKNPLILDSKSPKKTV
EASMYAENRFKMLTKSKPADAKRLLKEAQEDVSTRWKMYEYMAARPLETKGNNGHSEGKS
APISEGKPPETTPV
NT seq 3645 nt   +upstreamnt  +downstreamnt
atgaatacaaaaaattatgcaaccctagatggtaacgaagccgttgctcgtgttgcttat
cgtttgagtgaagttatcgccatttatccgatcaccccgtcctcacccatgggagaatgg
gctgatgcttgggcctccgtgggggataaaaacctctgggggacggttccggccgtggta
gaaatgcaaagcgaaggcggggcggctggggccgtacacggggctttacaagcgggttcc
ctgacaaccaccttcaccgcatcccaagggttaatgttaatgctccccaacctctacaaa
atcgcgggagagttaacctgtgccgtgatccaagtggccgcccgttccttagccgcccaa
gggttatctattttcggcgaccatagtgatgtgatggcagctagggccacggggttcgcc
ctgttgtgttccgcctcggtgcaggaagcccaggatatggccttaattgcccaggcatcc
accctagaatcacgaattccttttattcacttttttgacggatttcgtacctcccatgaa
gtccaaaaaattgaactattagaggatagtgatatccgagaattaatcgatgataaatac
gtttatgaacatcgcaaccgcgctttaacacctgaccgtcctgtcctgcgaggaacggct
caaaaccccgatgtttatttccaaggccgagaaaccgttaatattttttatgatcaaacc
cccgaaattgtacaacgggcaatggataaattggggcagttgacgggacgcaattataaa
ctatttgaatatcacggtgcccccgatgccgaacgggtaattattctcatgggttccggt
tgtgaaaccgtccatgaaaccgtggattatttgaatgcccaaggggaaaaattaggggta
ttaaaagttcgattatatcgtccttgggatggggaacaattaattgcggcactgccggaa
actgtcaaagcgatcgcggttttagatcggacaaaagaacccggttctagtggggaaccc
ctctatttagatgtggtgacggccgttcaggaagtgatgttaggagataacgataccctt
aaagctaagattaaaaaccttaaagcattggtagggggacgttatgggttatcttctaaa
gaatttaatccggcaatggttaagagtgtttttgagaatttagcccaaactaaacccaaa
aatcactttactattggtattaatgatgatgttagccacacctccttagaatacgatccc
agcttctccaccgaacccgataacgtggtgcgggcgatgttctatgggttaggtgcagat
ggtaccgttggtgctaataaaaactcgattaaaattattggggaagaaaccgataattat
gcccaaggatattttgtttatgactccaaaaaatctggggctgttaccgtatctcacttg
cgttttgggccgcaaccgatccggtcgatttatttaattagtaaggcgaattttatcggt
tgccatcaatggacgtttatcgaaagattagacgttctccaatgtgcgatggaaggttca
actttcctcttaaatagtccctacggccccgatcaagtttgggaatatctgcccttagaa
attcaagaagatattgttagaaaaaatctgaaattctatgttattgatgccaataaagtt
gcccgtgatacggggatgggaaaccgcatcaatactattatgcaggtgtgtttctttgcc
ttagcgaaagtattgccaagggaagaagcgatcgcccaaatcaaaaaagcgatcgaaaaa
acctatggtaagaaaggagcagaaattgttcgcttaaacttaaaggccgttgatgagacc
ctagaacacctttatgaagtcaacgttgcccaggccaacagcgccctacggcgagccgaa
cccgtagccgtcggagcccctacctttgttaaagaagttgaaggcatgatgatcgccgga
cggggggatgatttgcccgttagcaaactgccctgtgatggtacttatcccaccggaacc
tctaaatgggaaaaacgcaacgtcgcccaggatatcccggtttgggatgcggatgtctgt
atccagtgtggcaaatgtgtgatggtttgtccccatgccacaattcggggtaaagcctac
gatgaggctgccctggaaaacgcccccgccagtttcaaatttaccaacgttaaggataaa
gcctttaccggagaaaaattcaccatccaagtcgctcccgaagactgtaccggatgtggc
atctgtgtggatgtttgcccggccaaaaataaatccatgccttcgagaaaagcgatcaac
atggaaccccagttacccctgcgggaacaagaagctacgaattgggactttttcttgggt
attcccaaccctgatcggttaaaattacggccagatttgatccgtcaacaacaatggcaa
gagccgttatttgagttctccggcgcctgtggtggatgtggcgaaactccctatatcaag
ttggttacgcagttatttggcgatcggatgatcgtggccaacgccaccggatgttcctct
atttatggcgggaacttacccacaaccccctggacaacaaacgccgacggtcgcggcccg
gcttggtctaatagcttatttgaagataacgccgaatttggtttagggttccgaatgtcc
attgacaaacacgctgggtttgctctggaattgttacacaaactcggcggtgaggttggg
gataatttagttacccaaattaccgataacgcccaaaaatccgaggccgatatttgggaa
caacggcaacgggttgtccaactcaaagaaaaacttcaaggactcaattcccctgacgcc
caacagttacttagtttggccgactatttagtgaaaaaatccgtttggattattggggga
gatggttgggcctatgatattggttacggtggcttagatcacgtcattgccagtggccgt
aacgttaatattttggttttggatacggaagtttattccaacaccgggggtcagtcttct
aaagctaccccccgcggcgccgttgctaagtttgcggctggtggtaaaccctcggctaag
aaagacctcggcctcattgccatgacctacggtaacgtttatgtggcgagtgtggcgatg
ggggccaaggatgaacacaccctgaaagcgttcttggaagcggaagcctacgacgggcca
tcaattattattgcctattcccactgtattgctcacgggattaatatgacaacggctatg
acccatcaaaaagatctggtggaaagtggccgttggttactgtatcggtataacccagac
ttgaaagaagcaggcaaaaacccgttaattttggattctaaatcacctaagaaaaccgtt
gaggcgtctatgtatgcggaaaaccgtttcaaaatgttgaccaagagcaaacctgctgat
gccaaacggttgttaaaagaagcccaagaagacgtcagtacccgttggaaaatgtatgaa
tatatggccgctcgtccattagaaactaagggtaataacggtcattctgaagggaaatca
gccccaatttcggaaggtaaacctccagaaactacacctgtataa

DBGET integrated database retrieval system