KEGG   Planktothrix agardhii: NIES204_37790
Entry
NIES204_37790     CDS       T05658                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_37790
Enzymes [BR:pagh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     NIES204_37790
SSDB
Motif
Pfam: Glucosamine_iso
Other DBs
NCBI-ProteinID: BBD56449
UniProt: A0A2Z6CJ66
LinkDB
Position
4182982..4183716
AA seq 244 aa
MEKNIEILANREELIDRALEILLAKITEAIETRNQFTIALAGGSTPKPLYEALAQQPLPW
DKIHVFWGDERYVEPDHPDSNQKMAAQAWLDRVNFPATNIHPMPTLANNPIADAEQYNRE
LVQFFALNAGEFPAFDVVLLGMGDDAHTASLFPHTDALTVEDRLITVGNKDGQPRITFTV
PLINHARCVLFLVTGSNKQEPLAQVFATEGDAITYPSRLIQPVGELWWLLDQEAGAKLAE
NLPN
NT seq 735 nt   +upstreamnt  +downstreamnt
gtggaaaaaaatatagaaattttagcgaatcgagaggaactcattgatcgagctttagaa
atccttctggctaaaatcacagaagcaattgaaactcggaatcaatttacgatcgcctta
gccggagggagtaccccaaaacccctatatgaagccctagcccaacaacctttaccctgg
gataaaattcatgtattttggggagatgaacgctatgtggaaccggatcaccccgatagt
aaccaaaaaatggcagcgcaggcttggctggatcgggtaaatttccccgccactaatatt
catccgatgccaactttagccaataatcccattgccgatgcagaacaatacaatagggag
ttagtacaattctttgcgctcaatgccggagagttccccgcttttgatgtggttttatta
gggatgggagatgatgctcacaccgcatctttatttccccataccgatgccttaaccgtt
gaggatcgcttaattaccgttggcaataaggatggccagccccgaattacctttacagtt
cctttgattaatcatgcccgttgtgtcctgtttctggtcaccgggtcgaataaacaagaa
ccgttagcccaggtgttcgccaccgagggggatgccatcacctatcccagccgcctaatt
caacccgtgggagaactttggtggttattggatcaagaagcgggagccaaactcgctgaa
aatttgccaaattaa

DBGET integrated database retrieval system