KEGG   Planktothrix agardhii: NIES204_39580
Entry
NIES204_39580     CDS       T05658                                 

Gene name
panC
Definition
(GenBank) pantothenate synthetase PanC
  KO
K13799  pantoate ligase / CMP/dCMP kinase [EC:6.3.2.1 2.7.4.25]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00240  Pyrimidine metabolism
pagh00410  beta-Alanine metabolism
pagh00770  Pantothenate and CoA biosynthesis
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    NIES204_39580 (panC)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    NIES204_39580 (panC)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    NIES204_39580 (panC)
Enzymes [BR:pagh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.25  (d)CMP kinase
     NIES204_39580 (panC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase (AMP-forming)
     NIES204_39580 (panC)
SSDB
Motif
Pfam: Pantoate_ligase Cytidylate_kin Cytidylate_kin2 AAA_17 AAA_18 ADK TsaE SKI AAA_33 AAA_22 PRK RsgA_GTPase AAA_30 NB-ARC NACHT RNA_helicase Rad17 FAD_syn ABC_tran AAA_16 Viral_helicase1 dNK
Other DBs
NCBI-ProteinID: BBD56625
UniProt: A0A2Z6CJP7
LinkDB
Position
complement(4374514..4376031)
AA seq 505 aa
MVRLLTSVAALRCYLRSYRTQNPLNFVGLVPTMGGLHLGHLSLIQRAKAENGLVVVSIFV
NPLQFGPNEDFQNYPRRLETDLQQCEQAGVDVIFAPSVEEMYQSSVQTMVIPPTSIMSGL
CGKSRRGHFPGVATVVTKLLNLVQPDRAYFGQKDAQQVAIIQSLVQDLNLPIEIIPCPIV
RESSGLAYSSRNQYLTLSEQQQATVLYRALRRGQEYFHKGCNSATEIKTFVQTELETEPE
VQVEYIDLVEPQTLIPLATVETKGLLAIAARVGHTRLIDNLILHRRQAIIAIDGPAGAGK
STVTRKIAQALGLLYLDTGAMYRAVTWLVLQSGIAVEDEVAIAEIVSKCRIELIPDGEQP
RTLINGQDVTEAIRSLEVTAQVSAIAAQWAVRQALVKQQQAFGNKGGIVAEGRDIGTTVF
PDAELKIFLTASVQERAKRRLLELHSQGKTEITQEQLEQDIAERDRLDSNRVISPLRKAA
DAMEIQTDNLTIDDVIQRVVKSVIS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggttcgtctgttgactagcgttgctgctctgcggtgttatctgcgttcctaccgaact
caaaaccccctaaattttgtgggtctagtgcctacaatggggggcttacatttgggacat
ctgagcttaattcaacgggctaaagccgaaaatggtttggtggtggtgagtatttttgtg
aatcctctgcaatttgggccgaatgaggatttccaaaactatcctaggcggttagaaacg
gatttgcagcagtgtgaacaggccggagttgatgtgatctttgctccgtcggtggaggag
atgtatcaatcctcggtgcagacgatggtgattcctcctacatcaatcatgtcaggatta
tgcggaaaatctcgccgcggacattttccaggggtggcgacggttgtgaccaaattattg
aatttagttcaaccagatcgggcttattttggacaaaaagatgctcaacaggtggcgatt
attcaaagtctggttcaggatttgaatttgccaattgagattattccctgtccaattgtg
cgggagtcgtcgggattggcctatagttctcggaatcaatatttaactttatcagaacaa
caacaagcaacggttttatatcgggctctacgtcgtggccaagaatatttccacaaaggt
tgtaattctgctacggagattaaaacctttgtccaaactgaattggagacggaaccggag
gtacaggtagaatatattgatttagtggaaccccagacgttaattcccttagctacagtg
gaaaccaaggggttattagcgatcgcggctcgtgtgggtcacactcgtttaattgataat
ctgattctgcaccgtcgtcaagcaattatcgccattgatggcccagccggagccgggaaa
tctaccgttacccgcaaaattgcccaggcgttgggcctgttgtatttggatacgggggcg
atgtatcgggccgtgacctggttggtgttacagtctggaattgcggttgaggatgaagtt
gctatagctgaaattgtcagtaaatgtcggattgaattgatccccgacggagaacaaccc
agaaccctgattaatggtcaggatgtgactgaagcgattcgatccttggaagtgacggct
caggtatcggcgatcgcggctcaatgggctgtgcgtcaggctttagttaaacagcaacag
gcgtttgggaataaaggtggaattgttgctgaaggtagggatattggcacaacagtattc
cccgatgccgaattaaaaattttcctaactgcatctgtacaagagcgggcaaaacggaga
ttattagaactgcacagtcaaggtaaaacggaaattactcaggaacaattagaacaggat
attgccgagcgcgatcggcttgacagtaatcgagttatttcacccttgagaaaagccgct
gatgcgatggaaattcaaacggataatttaacaattgatgatgtgattcaacgggtcgtt
aaatcagtcatcagttaa

DBGET integrated database retrieval system