KEGG   Planktothrix agardhii: NIES204_40400
Entry
NIES204_40400     CDS       T05658                                 

Definition
(GenBank) ribulose-phosphate 3-epimerase
  KO
K01783  ribulose-phosphate 3-epimerase [EC:5.1.3.1]
Organism
pagh  Planktothrix agardhii
Pathway
pagh00030  Pentose phosphate pathway
pagh00040  Pentose and glucuronate interconversions
pagh00710  Carbon fixation in photosynthetic organisms
pagh01100  Metabolic pathways
pagh01110  Biosynthesis of secondary metabolites
pagh01120  Microbial metabolism in diverse environments
pagh01200  Carbon metabolism
pagh01230  Biosynthesis of amino acids
Module
pagh_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
pagh_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pagh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NIES204_40400
   00040 Pentose and glucuronate interconversions
    NIES204_40400
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    NIES204_40400
Enzymes [BR:pagh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.1  ribulose-phosphate 3-epimerase
     NIES204_40400
SSDB
Motif
Pfam: Ribul_P_3_epim His_biosynth
Other DBs
NCBI-ProteinID: BBD56707
UniProt: A0A2Z6CJJ8
LinkDB
Position
complement(4458745..4459446)
AA seq 233 aa
MTATQKPIVISPSILSADFSRLGEEIRAVDEAGADWIHVDVMDGRFVPNITIGPLIVEAI
RPVTKKPLDVHLMIVEPEKYVEGFAKAGADIISVHAEHNASPHLHRTLGQIRELGKQAGV
VLNPSTPLELIEYVLELCDLVLIMSVNPGFGGQKFIPGIVPKIRALRQMCDERGLNPWIE
VDGGLKGDNTWQVLEAGANAIVAGSAVFNAPDYAKAIEGIRHSKRPTPELATV
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaccgcaacccagaaaccgattgttatttccccctctatattatcagcagattttagt
cgtcttggtgaagaaattcgggcagtggatgaagctggcgccgattggattcatgttgat
gtgatggatggtcgcttcgttcccaatattactattgggccattaattgtggaagctatt
cgtccggtgacaaaaaaacctctggatgtccacttaatgattgtggaaccggaaaaatat
gtcgaaggttttgctaaagctggcgctgatattatttcggttcacgccgaacacaatgct
tctccccacttacatcgaacccttggccaaattcgagaactgggtaaacaagcgggtgtg
gttttgaatccttctactcccttagaattaattgaatatgtcttagagctttgtgacttg
gtgttaattatgagtgttaaccctggttttggcggacagaagtttatccccggaattgtg
ccgaaaattcgcgccttacgtcaaatgtgcgacgaacggggtttaaatccttggattgaa
gttgatggcggtctgaaaggggataatacttggcaagtgttggaagccggggctaacgcc
attgttgcgggttctgcggtgttcaatgctcctgattatgctaaagctattgaaggaatt
cgccatagtaaacgccctactcctgagttagcaacagtctaa

DBGET integrated database retrieval system