KEGG   Porphyromonas asaccharolytica: Poras_1035Help
Entry
Poras_1035        CDS       T01485                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pah  Porphyromonas asaccharolytica
Brite
KEGG Orthology (KO) [BR:pah00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Poras_1035
Enzymes [BR:pah01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Poras_1035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like DAO FAD_binding_2 FAD_oxidored NAD_binding_8 Thioredoxin_3 Thi4 Lycopene_cycl FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AEE12978
UniProt: F4KKQ3
LinkDB All DBs
Position
complement(1299428..1300981)
Genome map
AA seq 517 aa AA seqDB search
MRLDQDTLQQLQSIFASLKHRYTLRAKAPEGDHYGELEQLLGDFASTSPQISLEMSVGDK
LSVEILCDDQPTGITFRAIPSGHEFSSLILAIYNADGQGKNLPDVAICDKIRSLRKPIHL
RSYISLSCTNCPDVVQSLNLITLIAGEGVTHEMVDGALYTEEAKELSISAVPTVYLGDQV
LHIGKSSLGELLGKLAEAVGVEPSSVTAERKEYDQIVIGGGPAGAAAALYSARKGLHVAL
VADRMGGQVNETTAIENVPSVLHTTGTQLAEDLRQHVLHYQVEILEQRHVEQIKLVDTQK
EVVTSLGETLVAPQVIIATGASWRKLGVPGEAEHIGRGVAFCPHCDGPFFKGQDIAVVGG
GNSGIEAAIDLAGICKHVTVLEFMESLKADTVLQEQLAKLPNVTVHTNVATEEVIGDGSK
VSALRIAPRDGSAPFELAVAGVFVQIGLKANTDVFDGLVERNRMGEIIIDDHCRSSVAGI
YAAGDCASIPYKQVVIAMGEGAKAALSAFDDRIRTKG
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgagactagaccaagataccttacagcaactgcaaagcatctttgcctcgctaaagcat
cgatacacacttagagcgaaggctcccgagggtgaccactacggggagctagagcagctc
ctcggcgacttcgcctcgacctctccgcaaatatcgctagagatgagcgtgggcgacaag
ctgagcgtggagatactgtgtgacgaccagcccacggggataacctttagagcaatcccc
tcggggcatgagtttagcagtctgatactggccatatacaatgcggatggtcaggggaag
aacctccccgatgtggctatctgcgacaagatccgttcactacgcaaacctattcatcta
cgcagttacatttcgctcagctgtaccaactgccccgatgtggtgcagagccttaaccta
atcacgctcatagcgggtgagggggtgacccacgagatggtcgacggagctctctacacg
gaggaagctaaggagctaagcatatcggccgtaccgacggtctacctgggagatcaggtg
ctacatataggtaagagttcgctgggtgagctactcggcaagctagccgaagctgtcgga
gtggagccatcgtccgtcacggcagagcgcaaggagtacgaccagatcgtcatcggtggt
ggtcctgcgggtgcagctgctgcactatactctgctcgcaagggactgcacgtggcactt
gtggcagaccgcatgggtggtcaggtgaatgagacaacggctatcgaaaacgtcccctcc
gtgcttcacaccacagggacgcagcttgccgaagatctgcgccagcatgtgctacactac
caggtagagatactagagcagagacatgtcgagcagatcaagcttgtcgacacccagaaa
gaggtagtcacctcgctcggcgagacgctcgtggcaccgcaagtgatcattgccactgga
gcctcctggcgcaagctaggtgtgccaggtgaggcggagcatattggtcgcggggtagcc
ttctgtccgcactgcgacgggccgttcttcaagggacaagacatagcggtcgtgggcggt
ggtaactcaggcattgaggctgctatcgacttagcgggcatctgcaagcatgtgaccgtc
ttggagtttatggagagcctcaaggcagacactgtactgcaggaacagctggctaagcta
ccgaacgtgaccgtccacacgaacgtggcaacggaagaggtcatcggcgacggcagcaag
gtgtccgcactgcgcatagctcctcgtgacgggagtgctcccttcgaactcgctgtcgct
ggggtctttgtgcagatcgggctcaaggctaatacggatgtcttcgatggtctggttgag
cgcaaccgcatgggcgagatcatcatcgacgaccactgccgcagctccgtagcgggtatc
tatgccgcaggcgactgtgccagcatcccctacaagcaggtggtgatcgctatgggcgag
ggtgccaaggctgctctctcggccttcgacgatcgcattcgcacgaaaggatga

DBGET integrated database retrieval system