KEGG   Pyrobaculum aerophilum: PAE0833Help
Entry
PAE0833           CDS       T00073                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai03030  DNA replication
pai03410  Base excision repair
pai03420  Nucleotide excision repair
pai03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    PAE0833
   03410 Base excision repair
    PAE0833
   03420 Nucleotide excision repair
    PAE0833
   03430 Mismatch repair
    PAE0833
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pai03032]
    PAE0833
   03400 DNA repair and recombination proteins [BR:pai03400]
    PAE0833
Enzymes [BR:pai01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PAE0833
    6.5.1.6  DNA ligase (ATP or NAD+)
     PAE0833
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     PAE0833
DNA replication proteins [BR:pai03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    PAE0833
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     PAE0833
DNA repair and recombination proteins [BR:pai03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     PAE0833
   NER (nucleotide excision repair)
    Other NER factors
     PAE0833
   MMR (mismatch exicision repair)
    Other MMR factors
     PAE0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 PocR
Motif
Other DBs
NCBI-ProteinID: AAL63064
UniProt: O93723
LinkDB All DBs
Position
479299..481053
Genome map
AA seq 584 aa AA seqDB search
MQFGELVKALAAIEATTQRTTMVKLLVSLFKKASPEEVGKIVYFILGDLRPPWEGVELGV
AEKLCLRAVSKATGAAVSELEALYKKTGDVGEAARRALAASKRPGLLAFGSQKPLEVSEV
YDTLLKVARATGEGAQDMKVALLSSLFARATPEEGKYIARFVVGKLRLGVADMTIIEALS
DAYGVNKEALEKAYHIYPDLGRLAKHVAEGKPLDEIRITPGVPVLPMLAQRLSSASEILA
KLGGSAICEYKYDGERAQIHLTPGGVKIFSRRLEDITHAYPDVVKAVKEAVSAKEAILEG
EIVAVDPDTGDMLPFQELMHRKRKHDVATAVELYPTVLYLFDVLYVDGEDLTEEPLIYRR
VRLSEIVCETDKVSIAKWRIFDNAEAVDVFFHESVSMGTEGLICKSPSSIYEMGARGWNW
IKYKRDYRSEMIDTVDLVVVGAFHGRGKRAGLYGAFLLAAYDPSTDMFYTVCKVGSGFTD
ADLKKMYEILQPFKIPHRHPRVVSKMEADVWFVPQVVIEVIGAEITLSPLHTCCLGAVRP
GVGLAVRFPRFTGRYRSDKSPEQATTVAEMLELYKRQKKVVQPE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
gtgcagtttggggagttagttaaggcacttgcggcaattgaggccaccactcagaggaca
acaatggtcaagttgctcgtctcgctttttaaaaaggcgtctccagaggaggtcgggaaa
attgtgtacttcatcctcggcgatttgaggcctccttgggagggggttgagttgggggtt
gctgagaagctctgtttgagggcggtttctaaggccacgggggcggccgtatccgagctg
gaggctttgtataagaaaacgggcgacgtgggcgaggcggcgcgtcgcgccttggccgcg
tctaaacgccctggtttactggcctttggctctcaaaagccgcttgaggtgtctgaagtt
tacgacacgttgttaaaagtggccagggcaacgggggagggggctcaagatatgaaagtg
gctttgctgtcctctctctttgccagggcgactccagaggaggggaagtacattgccaga
tttgttgtggggaagttgaggctgggcgtcgccgacatgactattattgaggcgctttca
gacgcctacggagttaataaggaggctttagaaaaggcgtatcacatataccccgactta
ggccggctggctaaacacgtcgccgagggcaagccgcttgacgaaataagaattactccc
ggcgtgccggtgcttcccatgttggcgcagaggctgtcttccgcctctgagattttggct
aagctgggcggctcggcgatttgcgagtataaatacgacggagagagggcccagatacac
ctcactccaggcggcgtgaaaatattcagcaggaggcttgaggacatcacccacgcctat
cccgatgttgtcaaggcggttaaagaggctgtgtccgcaaaggaggcgattttagagggg
gagatagtggctgttgatcccgatactggggacatgttgccttttcaagagcttatgcat
aggaagaggaaacacgatgtggcaacagccgtggagctgtaccccacagtgttgtattta
tttgacgtcttgtacgtcgacggcgaggatttaacagaagagcctcttatatacaggagg
gtgaggctttctgaaattgtctgcgagactgacaaggtgtcaatagccaagtggagaatt
tttgacaacgccgaggctgttgacgtctttttccacgagtctgtgtctatgggcactgag
ggcttgatatgtaaatcgccttcttcaatttacgaaatgggggccaggggctggaactgg
attaaatacaagcgggattaccgtagcgagatgatagatacagtagacctcgttgtagta
ggcgccttccacggcaggggcaagagggccggcctatacggcgcctttctcttggcggca
tacgatccttccactgacatgttttatactgtgtgtaaagttggaagtgggtttacagac
gccgatttgaaaaaaatgtacgagattttgcagccgtttaaaatcccccacagacacccc
agagttgtgtctaaaatggaggcggatgtgtggttcgtgccccaggtagttattgaggtt
ataggggctgagattactctgtcgcctctccacacttgctgtttaggcgcagtgcgcccg
ggggttgggctggcggttagattccccagatttactggccgttatagatctgacaaatcc
ccagagcaagcaacgacggtggcggagatgttagagctgtacaagaggcagaaaaaagtg
gttcagcccgagtag

DBGET integrated database retrieval system