KEGG   Pyrobaculum aerophilum: PAE1679Help
Entry
PAE1679           CDS       T00073                                 

Definition
(GenBank) D-arabino 3-hexulose 6-phosphate formaldehyde lyase, conjectural
  KO
K08093  3-hexulose-6-phosphate synthase [EC:4.1.2.43]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00030  Pentose phosphate pathway
pai00680  Methane metabolism
pai01100  Metabolic pathways
pai01120  Microbial metabolism in diverse environments
pai01200  Carbon metabolism
pai01230  Biosynthesis of amino acids
Module
pai_M00580  Pentose phosphate pathway, archaea, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:pai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PAE1679
  09102 Energy metabolism
   00680 Methane metabolism
    PAE1679
Enzymes [BR:pai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.43  3-hexulose-6-phosphate synthase
     PAE1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OMPdecase HMGL-like
Motif
Other DBs
NCBI-ProteinID: AAL63652
UniProt: Q8ZWP8
LinkDB All DBs
Position
983907..984557
Genome map
AA seq 216 aa AA seqDB search
MKLQVALDLVDLRKAVNLARELCSVGAEMIEAGTPLIKLYGMASVSAIKSACPKAEVVAD
IKTADVGGLEARLAREFGADWGTVLGMTNLETIVEFIKEGKAVGLKTAVDLIGSRDPEGR
AQEILKAARPDLFIVHLGVDVQTRTGMRFEDLLEIALKIKNMGVGVAVAGGITERELELI
IKRGAQVDVVVVGRSIVNDTSPASKFVMMNNILKHI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaactccaggtggcgcttgacctcgtagatctcaggaaagccgtaaatctggcgcgc
gagctgtgtagcgtcggcgcggagatgatagaggcgggaactccgctgattaagctctac
ggcatggcgtcagtaagcgccattaaatcagcatgtcccaaggccgaggttgtggccgat
ataaaaactgcagacgtaggaggcttggaggcgaggctcgcgagggagttcggcgccgat
tggggcacagtgctgggcatgacaaacctcgagaccatcgtcgaatttataaaagagggg
aaagccgtgggcctcaagacagcagtcgatttaatcggatcgcgtgaccctgagggcaga
gcccaggagatattaaaagcggctcgccccgatctcttcatagtgcacttaggcgttgac
gtccaaacgaggactgggatgcgatttgaggacctcttagaaattgcgcttaaaataaaa
aacatgggcgtgggagtcgccgtggcaggcggcattaccgagcgggagcttgaacttatt
atcaagcgcggggctcaagttgatgtggttgttgttggcagaagtattgtaaacgatact
tcgcctgcgtcaaaatttgtaatgatgaacaacattttaaaacatatctaa

DBGET integrated database retrieval system