KEGG   Paenibacillus sp. IHB B 3084: ASL14_03080Help
Entry
ASL14_03080       CDS       T05348                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00020  Citrate cycle (TCA cycle)
paih00480  Glutathione metabolism
paih01100  Metabolic pathways
paih01110  Biosynthesis of secondary metabolites
paih01120  Microbial metabolism in diverse environments
paih01130  Biosynthesis of antibiotics
paih01200  Carbon metabolism
paih01210  2-Oxocarboxylic acid metabolism
paih01230  Biosynthesis of amino acids
Module
paih_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paih_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASL14_03080
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASL14_03080
Enzymes [BR:paih01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ASL14_03080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ALP35311
UniProt: A0A0S2S0S5
LinkDB All DBs
Position
complement(669198..670493)
Genome map
AA seq 431 aa AA seqDB search
MAKFEKFELPTEGEKITIDNGQLQVPNYPVIPFIEGDGTGRDIWKASKRVLDAAVDKAYN
GSKKIAWYEVFAGEKAFNTYGEWLPNDTLEAIREYIVAIKGPLTTPIGGGIRSLNVALRQ
ELDLYVCLRPVRYFNGVPSPVKRPELVDMVIFRENTEDIYAGIEYAEGSEDVKKVIQFLQ
QELGVNKIRFPETSGIGIKPVSSEGSKRLVRAAIQYAVDHGRKSVTLVHKGNIMKFTEGA
FKNWGYEVAEEEFADKVFTWAQYDAIKEKDGEDAANAAQKAAEDAGKIIIKDAIADIALQ
QVLTRPSEFDVIATLNLNGDYLSDALAAQVGGIGIAPGANINYVTGHAIFEATHGTAPKY
ADKDVVNPGSVILSGVMLLEHLGWHEAANLIYKGLETSINKKIVTYDFARLMEGATQVKC
SEFADTIISNL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatttgaaaagtttgagctcccaactgaaggcgaaaaaattacgattgataac
ggtcaactacaggttccgaattatccggttattccgtttatcgaaggcgacggcacaggc
cgcgacatctggaaagcatccaagcgcgtactggacgcagctgtagataaagcatataac
ggttccaaaaagattgcctggtatgaagtattcgctggtgagaaagctttcaatacatac
ggcgagtggttgcctaacgataccttggaagccatccgtgagtatattgtagccatcaaa
gggccgcttacgacaccgattggcggcggcattcgctctttgaacgtagcattgcgtcaa
gaactggatctgtacgtatgtctgcgtcctgttcgttactttaacggtgttccttctccg
gtgaagcgtcctgaattggtagacatggttattttccgtgagaatactgaggatatctat
gctggtattgagtatgctgaaggctccgaggacgtaaaaaaagtcattcagttcctccaa
caagagctgggtgtgaacaaaatccgtttccctgaaacgtcgggtatcgggatcaagccg
gtttcctccgagggttcaaaacgtctggtacgtgcagccattcagtatgctgttgaccac
ggacgaaagagcgtaacgctcgtacacaaaggcaacattatgaaatttaccgaaggtgcc
ttcaaaaactggggttatgaagtggctgaggaagaatttgcagataaagtatttacttgg
gctcaatatgatgcaatcaaggaaaaagatggtgaagatgcggcaaatgcagctcaaaaa
gcagcagaagatgcaggcaaaatcatcatcaaggatgcgatcgctgacattgcacttcaa
caagtgctgactcgtccttccgaatttgatgtcattgctacactgaacctgaacggagac
tatctgtccgatgcgctggctgctcaagtcggtggaattggtatcgcaccaggtgcgaac
attaactatgtaactgggcatgctatctttgaagctacacacggcacagcgccaaaatat
gctgacaaagatgtcgtaaaccctggttccgttattttgtccggcgtgatgctgcttgag
catttgggctggcacgaagcggcaaacctgatttacaaaggactggaaacgtccattaat
aagaaaatcgtaacgtatgactttgctcgcctgatggaaggcgctacacaagtgaaatgc
tccgagttcgcagataccattattagtaacctgtag

DBGET integrated database retrieval system