KEGG   Paenibacillus sp. IHB B 3084: ASL14_10995Help
Entry
ASL14_10995       CDS       T05348                                 

Definition
(GenBank) bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase
  KO
K11755  phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase [EC:3.6.1.31 3.5.4.19]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00340  Histidine metabolism
paih01100  Metabolic pathways
paih01110  Biosynthesis of secondary metabolites
paih01230  Biosynthesis of amino acids
Module
paih_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    ASL14_10995
Enzymes [BR:paih01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     ASL14_10995
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     ASL14_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-CH PRA-PH MazG
Motif
Other DBs
NCBI-ProteinID: ALP36610
UniProt: A0A0S2S4T6
LinkDB All DBs
Position
complement(2399050..2399790)
Genome map
AA seq 246 aa AA seqDB search
MSNELNQQLSLEQVLDNIRWNEAGLVSAIVQDNATLQVLTLAYMNRESLKLSLESGETWF
WSRSRQELWHKGATSGNTQKITSIQLDCDGDALLIRVIPNGPACHTGATSCFFRDISAPG
TAVAPASENAGGQVSVATQPGTTHAATDRFEVLAQLEAIIKEREVTRPEGAYTTYLFDKG
VDKILKKVGEEASETIIAAKNKDNEELRLEVSDLIYHLLVLLQERKLPLDDVLAELNRRH
ERPRRD
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaattgaaccagcagctatctctggaacaggtattggataatattcgctgg
aatgaagcgggacttgtctcagcgattgtgcaggataatgccacgcttcaagtattgacg
ctggcctatatgaatcgagaatcgctgaagctttctctggaatcgggagagacgtggttt
tggtcccgttccagacaggagctgtggcacaagggggcaacctcggggaatacgcaaaaa
atcacctctatccagttggattgtgacggtgacgctctgctcatccgtgtgattccgaat
ggtcctgcctgccatactggagcaacgagctgctttttccgtgatatttccgcgccagga
acggctgtagctcctgcttcggaaaatgccgggggccaagtgtcggtggcgactcaaccg
ggtacgactcatgctgcaacagaccgctttgaggtgcttgcccagctggaagcaatcatt
aaggagcgggaagtgacacgtcctgaaggggcctatacgacctacctttttgacaaaggc
gtggataagattctgaaaaaggttggcgaagaagcatccgagacgatcattgccgccaag
aataaggataatgaggagcttcgtctggaggtcagcgatctgatttatcacttgctggta
ctgttacaggagcgcaaactaccgctggatgatgtgctggctgagctgaaccgccgtcac
gaacgtccccgtcgtgattaa

DBGET integrated database retrieval system