KEGG   Paenibacillus sp. IHB B 3084: ASL14_12565Help
Entry
ASL14_12565       CDS       T05348                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00440  Phosphonate and phosphinate metabolism
paih01100  Metabolic pathways
paih01120  Microbial metabolism in diverse environments
paih01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    ASL14_12565
Enzymes [BR:paih01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     ASL14_12565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-ProteinID: ALP36871
UniProt: A0A0S2S5A3
LinkDB All DBs
Position
2739475..2740374
Genome map
AA seq 299 aa AA seqDB search
MKKTKQLRELVNSQKLEFIMEAHNGLSAKIVEEAGFKGIWASGLSISAAMGVRDNNEASW
TQVLDVLEFMSDATSIPILLDGDTGYGNFNNARRLVKKLEQHHIAGVCIEDKRFPKMNSF
INGQGQTLADIEEFSGKIKAMKDTQTDADFTVVARVEAFIAGKGLKVALQRAEAYRKAGA
DAVFIHSKRSDAAEIEAFMKEWAGRLPVVIVPTKYYTTPTVRFKEMGISLVIWANHNLRA
SIQAMKQLSDRIYRDESLVHIEKSVATLEEVFRLQGVEELQAAERQYLPSSEPDSGEHV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaaagcagctaagagagttggtcaattctcaaaaactggagtttatcatg
gaagctcataatggtctgtcagccaaaattgtggaggaggcggggtttaaaggaatttgg
gccagcgggttgtccatctctgcagcgatgggagtcagggacaacaatgaggcttcctgg
acgcaggtattggatgttttggaattcatgagtgacgctacttccatcccgattttactg
gacggagatacggggtacggcaacttcaataatgcaaggcggctggtgaaaaaactggag
cagcatcatatagcgggggtatgcatcgaagataagcggttccccaaaatgaattctttc
attaacggtcaagggcagactttggctgatatcgaagagttttccgggaaaattaaagcg
atgaaagatacgcaaacggacgcggactttacggtggtggccagagtagaggcatttatt
gccgggaaagggcttaaagtggcgctgcagcgggcagaggcgtaccggaaggcaggagcc
gatgccgtatttatacacagcaaaagatcggatgccgcagagattgaagcgttcatgaag
gaatgggccggaagattgccggtagtgatcgtgcctaccaaatactatacgactccaacc
gtcaggtttaaggagatggggatcagccttgtgatttgggcaaaccataatttgagagca
tccatccaagccatgaaacaattatctgaccgaatttatcgggatgaaagccttgttcat
atcgagaagagcgtcgcaaccctcgaagaagtattccggcttcaaggggtcgaggagctg
caggctgcggaacggcaatacctcccgtcgtcagaaccggattcgggtgagcacgtataa

DBGET integrated database retrieval system