KEGG   Paenibacillus sp. IHB B 3084: ASL14_13175Help
Entry
ASL14_13175       CDS       T05348                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00500  Starch and sucrose metabolism
paih01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ASL14_13175
Enzymes [BR:paih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ASL14_13175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_14 CBM_25 Alpha-amylase CBM53 Glyco_hydro_42 Cyc-maltodext_C Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: ALP36976
UniProt: A0A0S2S5N0
LinkDB All DBs
Position
complement(2868101..2871526)
Genome map
AA seq 1141 aa AA seqDB search
MTLYRSIWKKGCLILLSLVLSLTAFIGSPSNTASAAVADDFQASVMGPLAKISDWGAFKK
QLQTLKSNGVYAITTDVWWGYVESAGDNQFDWSYYKTYADAVKEVGLKWVPIISTHKCGG
NVGDDCNIPLPSWLSSKGSADEMQFKDEGGYVNNEALSPLWSGTGKQYDELYASFAETFA
GYKSIIPKIYLSGGPSGELRYPSYYPAAGWSYPARGKFQAYTETAKNAFRTAMNEKYGSL
DKINAAWGTKLSSLSQINPPTDGDGFYTNDGYNSTYGKDFLSWYQSVLENHLGVIGAAAH
KNFDSVFGVRIGAKISGLHWQMNNPAMPHSTEHAGGYYDYNRLIQKFKDADLDLTFTALE
MNDSGTAPNYSLPSTLVDTVSSIANSKGVRLNGENALPTGGSGFQKIEEKITKFGYHGFT
LLRLNNLVNSDGSPTGDMDGFKKVIVSKAKPGDNGGGTGNKVTVYYKKGFNSPYIHYRPA
GGNWTAAPGVKMQDAEISGYAKITVDIGSASQLEAAFNDGNNNWDSNNTKNYLFSIGIST
YTPGNSGNTGTITSGAPSGTNPGDGGGTTNKVTVYYKKGFNLPYIHYRPAGGNWTSVPGV
KMQDAEISGYAKITVDIGSASQLEAAFNDGNNSWDSNNTKNYFFSTGTSTYTPGSNGAAG
TIQTGSPSGGSTPTDPGNPSNPTPLSTDWSKQSIYFIMTDRFSNGDTSNDNYGGFNSNNS
DQRKWHGGDFQGIINQLDYIQNMGFTAIWITPVTMQKSEFAYHGYHTYDFYAVDGHLGTM
DKFKELVRKAHDKNMAVMLDVVPNHTGDFQPGNGFAKAPFDKADWYHHNGDITGADYSSN
NQSKIENGDVAGLDDLNQDNPATASELKNWIKWLLNETGIDGLRVDTAKHVPKGFLKDFD
QAANTFTIGEIYSSDPAYVGDYTRYLDAALDFPMYYTIKDVFGRDQSMTKIKERYTDDRH
YRDAQTNGVFIDNHDVKRFLNEASGKPGASSEKWPQLKAALGFTLTSRGIPIIYQGTEQG
FSGGDDPANRENVVFNANHELYQYIAKLNRVRNSHPALQNGSQKEKWADDSFYSFQRSKN
GDEAIVLINNSWNSQTRTIGNFDNLSNGTRLTNQLSNDSIQINNGSITVTLGPKEVKVFT
K
NT seq 3426 nt NT seq  +upstreamnt  +downstreamnt
ttgaccttgtatcgaagtatatggaaaaaagggtgcctgattctattaagccttgtgctg
tctttgaccgccttcattggctccccctccaatacggcaagcgctgcagtcgctgacgat
tttcaagcttccgtcatggggccgctggcgaaaatcagtgactggggcgcattcaaaaag
caactgcaaacgctgaaaagcaacggcgtgtatgccatcaccaccgatgtctggtggggc
tatgtggaaagcgcaggagataaccagttcgattggagctattacaagacctatgcagac
gctgtgaaagaggtaggtctgaaatgggttcctattatctctacgcataagtgcggcgga
aatgtgggtgatgactgtaacatcccgctgccaagctggctgtcgagcaagggcagtgca
gatgaaatgcaattcaaggatgaaggcggctatgtgaataacgaagccctttccccatta
tggagcggaactggcaaacaatatgacgagctgtatgcgtcatttgctgaaacctttgct
ggctacaaaagcatcattcccaaaatctatttaagcggtgggccgtctggagaattgcga
tatccttcatactatccggcagcgggatggagctatcctgcacggggcaaattccaagcc
tacaccgaaacagccaaaaatgcgttccgcactgccatgaatgaaaagtatggatcattg
gacaagattaatgcggcttggggtaccaagctaagcagccttagccaaattaatcctccg
accgacggggacggattttacacgaacgatgggtataattccacgtacgggaaggatttc
ctgtcgtggtaccaaagcgtgcttgaaaaccatctgggtgtcatcggagctgctgcccac
aaaaacttcgattctgtgttcggtgtccgcatcggagcgaagatttccggcctgcactgg
cagatgaacaatcctgcaatgcctcacagcacagagcatgcaggtggatattatgattac
aaccgtcttattcagaagttcaaggatgctgatctggatctaacctttactgcgctggag
atgaacgacagtggcacagcaccgaattattccttgccatccacactggtagataccgtc
tcctccattgcgaatagcaagggtgttcgcctgaatggtgaaaacgcactcccaacggga
ggcagtggcttccagaaaatcgaagaaaaaatcacgaagttcggctaccacggctttaca
ctattgcgccttaataatctcgttaacagtgatggctcacccaccggagatatggatgga
ttcaaaaaggttatcgtaagcaaggccaagcccggcgataacggaggcggtacaggcaac
aaagtaaccgtatactacaaaaagggcttcaactcgccttacattcactaccgcccggct
ggcggaaactggactgctgcacctggcgtgaaaatgcaggatgccgagattagcggctat
gccaaaatcaccgtcgatatcggttctgcctcccaactagaggctgcctttaatgatggc
aacaacaactgggacagcaataataccaaaaactacttattcagtataggcatttctacc
tacacgccaggcaacagcggcaatacgggaaccatcacctcaggtgctccatcgggtact
aaccccggagatggcggcggtacaaccaataaagtaaccgtatactacaaaaaaggcttc
aacttaccttacattcactaccgcccggctggcggaaattggacttccgtacctggtgtg
aaaatgcaggatgccgagattagcggctatgctaaaattaccgtcgatatcggctctgcc
tcccaattggaagccgcttttaacgacggcaataacagctgggacagcaacaacaccaaa
aattacttcttcagtacaggaacttctacctacacgcccggctctaacggagccgcggga
actatccaaacggggtcgccttcgggcggctctactcccactgatccgggtaatccctcc
aatccaactccccttagcacagactggagcaaacagagcatttactttatcatgacagac
cgattcagcaacggggatacatccaacgataattacggtggcttcaactccaacaacagc
gaccagcgcaagtggcatggcggcgattttcaaggcattatcaaccagctcgactacatt
caaaatatgggctttaccgccatctggattactccggtaacgatgcaaaagagcgaattc
gcttaccacggctatcatacgtatgatttttatgcggtagatggacatcttggcacgatg
gacaagttcaaggagttggtccgtaaagcacacgacaaaaatatggctgttatgctggac
gtagtccccaatcacacgggcgattttcaaccaggaaacggcttcgccaaggctcctttt
gataaagcagactggtatcatcacaatggcgacatcacaggggcagactacagctccaat
aaccaatcaaaaatcgaaaacggtgacgtggccggattggatgatctgaatcaggacaac
cctgcaaccgcaagcgaacttaaaaactggatcaagtggctgttgaacgagacgggcatc
gacggactgagagtagacaccgccaaacatgtaccgaaaggctttttaaaggattttgac
caagcagccaacactttcaccatcggtgaaatttacagcagcgatcccgcttatgtgggc
gattacacccgatatcttgatgctgcactggattttccaatgtattatacgatcaaggat
gtgtttggacgcgatcaatccatgaccaaaatcaaggaacgctatacggatgaccgtcac
tatcgcgatgcccaaaccaacggcgtatttatcgacaatcatgatgtgaaacgtttcctt
aacgaggcctccggcaagcctggtgccagctctgaaaaatggccacagctcaaagcagcc
ttaggctttactttgacgtcgcgcgggattccaatcatctatcaaggcaccgagcaaggc
tttagtggcggagatgatcccgccaaccgggaaaatgtcgtgttcaacgccaaccatgag
ctgtaccagtacattgccaagctgaaccgtgtgcgcaacagccaccccgctctgcaaaac
ggcagccaaaaggaaaaatgggcggacgactccttttacagcttccagcgctctaaaaac
ggtgacgaggccattgtacttatcaacaactcgtggaacagccaaacccgtacgattggc
aactttgacaacctgtccaacggcacccgtctgaccaaccagttaagcaacgactccatt
cagatcaacaacggttcgatcaccgtgactctcggtccaaaggaagttaaagttttcacc
aaatga

DBGET integrated database retrieval system