KEGG   Paenibacillus sp. IHB B 3084: ASL14_17680Help
Entry
ASL14_17680       CDS       T05348                                 

Definition
(GenBank) bacillolysin
  KO
K01400  bacillolysin [EC:3.4.24.28]
Organism
paih  Paenibacillus sp. IHB B 3084
Brite
KEGG Orthology (KO) [BR:paih00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:paih01002]
    ASL14_17680
Enzymes [BR:paih01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.28  bacillolysin
     ASL14_17680
Peptidases [BR:paih01002]
 Metallo Peptidases
  Family M4: thermolysin family
   ASL14_17680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M4_C Peptidase_M4 FTP PepSY Glyco_hydro_108
Motif
Other DBs
NCBI-ProteinID: ALP37751
UniProt: A0A0S2S7U2
LinkDB All DBs
Position
complement(3862609..3864387)
Genome map
AA seq 592 aa AA seqDB search
MKKVWVSLLGGAMLLGSVASGASAESSVSEPSQLTPTFHTEQWKAPSSVSGDDIVWSYLN
RQKKTLLGTDSTSVRDQFRIIDRTSDKSGVSHYRLKQYVNGIPVYGAEQTIHVGKSGEVT
SYLGAVITEDQQQEATEGTTPKISATEAVYTAYEEAATRIQALPSSDDTISTDAEKQSSV
SKDTYAEAANNDKTTSVDKDELSLDKASALKDSKIEAVETEQSSIAKIANLQPEVDPKAD
LYFYPNGDTLQLVYVTEVNVLEPAPLRTRYIIDANDGKIVFQYDIINEATGTGKGVLGDT
KSFNTTQSGSSYQLKDTTRGNGIVTYTASNRQTIPGTLLTDADNVWNDPAGVDAHAYAAK
TYDYYKDKFGRNSIDGRGLQLRSTVHYGSRYNNAFWNGSQMTYGDGDGTTFIAFSGDPDV
IGHELTHGVTEYTSNLDYYGESGALNESFSDIIGNDIQRKNWLVGDDIYTPNIAGDALRS
MSNPTLYDQPDHYSNLYKGSSDNGGVHTNSGIINKAYYLLAQGGTFHNVTVSGIGRDAAV
QIYYSAFTNYLTSTSNFSNTRAAVVQAAKDLYGANSAQATAAAKSFDAVGVN
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtatgggtttcgcttcttggaggagctatgttattagggtcggtagcgtct
ggtgcatctgcggaaagttccgtttcagagccaagtcagcttacgccaaccttccacacc
gagcaatggaaggccccttcatcggtgtcgggtgacgacattgtatggagttatttgaat
cgacaaaagaaaacgttgctaggtacggacagcaccagtgtccgtgatcaatttcgcatc
attgatcgtacaagcgacaaatccggtgtaagtcattatcggctgaaacagtatgtgaac
gggattcccgtatatggagctgaacagacgattcatgtgggcaagtctggtgaagtcacc
tcttatctgggggccgtgattactgaggatcagcagcaagaagctacggaaggtacaact
ccgaaaatcagtgctaccgaggccgtatataccgcttatgaagaagcagctacacggatt
caagccctcccttcctccgacgatacgatctctacagatgctgaaaagcaaagcagtgta
agtaaagacacttacgcagaagctgctaacaacgacaaaacaacatctgttgataaggac
gagcttagtcttgataaagcgtctgccctgaaagatagcaaaattgaagcggtggagaca
gaacaaagttccattgccaaaattgctaatctgcagcctgaagtagatcctaaagccgat
ctgtacttctatcctaacggggataccctgcagctggtttatgtgacagaagtcaatgtt
ttagagcctgcgccactgcgtactcgctacatcattgatgccaatgatggtaaaatcgta
ttccaatatgacatcattaatgaagcgacaggcacaggtaaaggtgtgcttggtgatacc
aagtcgttcaacactacgcagtccggaagcagctatcaattaaaagacacaacacgtggt
aacggaatcgtgacctacacggcctccaatcgtcagaccattccaggtacgctcctgacg
gatgccgataacgtatggaatgatccagccggcgtagatgctcatgcttatgcggccaaa
acatatgattactataaggacaaattcggacgcaacagtattgacgggcgtggcctgcaa
ctccgttcgacggtccattacggcagccgctacaacaacgccttctggaacggctcccaa
atgacttatggagacggggacggtaccacatttatcgctttcagtggtgatcccgatgta
attggtcatgaactcacgcacggtgttacagagtatacttcaaatttggattattacggg
gaatccggtgcgttgaacgagtccttctcggacatcatcggcaatgacatccagcgcaaa
aactggcttgtaggcgatgatatttatacgccaaacattgcgggggatgctctgcgctct
atgtctaaccctaccctgtacgatcaaccagaccactattccaacttgtataaaggcagc
tcggataacgggggcgttcataccaacagcggcattattaataaagcatattatctgttg
gcacaaggtggtaccttccataacgtaactgtgagtggaattggtcgcgacgcagctgtc
caaatttactatagtgcctttacgaactacctgacttctacttccaacttctccaataca
cgcgccgctgtggtgcaagcagcaaaagacctttacggtgcgaattcagcgcaagcaacc
gcagccgccaaatcttttgacgctgtaggcgttaactaa

DBGET integrated database retrieval system