KEGG   Paenibacillus sp. IHB B 3084: ASL14_19715Help
Entry
ASL14_19715       CDS       T05348                                 

Definition
(GenBank) amino acid ABC transporter substrate-binding protein
  KO
K02424  L-cystine transport system substrate-binding protein
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:paih00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ASL14_19715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:paih02000]
    ASL14_19715
   02035 Bacterial motility proteins [BR:paih02035]
    ASL14_19715
Transporters [BR:paih02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Cystine transporter
    ASL14_19715
Bacterial motility proteins [BR:paih02035]
 Flagellar system
  Flagellar assembly proteins
   Chaperones
    ASL14_19715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd Phosphonate-bd NMT1 Flu_C_NS2 ODV-E18 ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: ALP38079
UniProt: A0A0S2S8Q7
LinkDB All DBs
Position
4299391..4300242
Genome map
AA seq 283 aa AA seqDB search
MKKFRFLPVVLIVMALLVSACGNNDKGANSNNASTGDAGPNNGKADTTATATLESVKASG
KLRIGTEGTYAPFTYHDAAGKLTGFDVDIATEVSKRLGVQPEFIETQWDGIFAGLNSKRF
DTVFNEVSITDERKQKYDFSDPYIVSKAVLIVSEDNNDIKKFADLKGKKAGQSLTSNLTQ
IAKSNGAEIVATDGFNQAIDLLTSKRVDATVNDGLSYLDLKKQKPDAPIKKVDESPDASH
SAAVFNKGSEDLIKEVNKALADMKADGTYLKISEKYFGADVSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatttagatttttaccagtcgtactgatcgtaatggctttgctggtttcggcc
tgcggcaacaacgacaaaggtgctaattcaaataatgcttctaccggggatgccgggcct
aataatggaaaagcagatacaaccgccacagctactttggaatctgtaaaagcgagcggt
aagctgcgaatcggtacggaaggtacctatgctccatttacctaccatgatgctgctggt
aagctgacaggcttcgacgtcgatattgcaactgaagtaagtaagcgtctgggcgtacag
ccggagtttatcgagacgcaatgggatggtatattcgcgggattgaactccaaacggttt
gacacggtgttcaatgaagtgtccattacagatgaacgcaagcaaaaatacgatttctcc
gatccgtacattgtctccaaggcagtgctgatcgtgagcgaagataataatgacatcaaa
aagtttgctgatctgaaaggtaaaaaggccgggcaatccctgaccagcaacctgactcaa
attgcgaagagcaatggcgcggaaattgtggcaacggacggattcaatcaggcgattgat
ctcctgacatccaaacgagtggatgcaaccgtcaatgatggtttgtcctatcttgatttg
aaaaagcaaaagcctgacgctcccatcaaaaaggtagatgaatctccagatgcttcacac
agcgcggctgtttttaataaaggtagcgaagacttgatcaaggaagtcaacaaagcgctg
gctgacatgaaggctgacggtacgtacctgaaaatttccgagaaatattttggagccgac
gtatccaaataa

DBGET integrated database retrieval system