KEGG   Paenibacillus sp. IHB B 3084: ASL14_24510Help
Entry
ASL14_24510       CDS       T05348                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
paih  Paenibacillus sp. IHB B 3084
Pathway
paih00010  Glycolysis / Gluconeogenesis
paih00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:paih00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASL14_24510
   00500 Starch and sucrose metabolism
    ASL14_24510
Enzymes [BR:paih01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ASL14_24510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase Glyco_hydro_42
Motif
Other DBs
NCBI-ProteinID: ALP38846
UniProt: A0A0S2SAT9
LinkDB All DBs
Position
complement(5363070..5364485)
Genome map
AA seq 471 aa AA seqDB search
MSTQFPKDFLWGGAVAANQLEGAYQEDGKGWSIQDVTPRGGWGPVTDVPTEDNMKLIGID
FYHKYKEDIKLFAEMGFKVFRTSIAWSRIFPKGDELEPNEQGLQFYDDLFDELHKYGIEP
LVTLSHYETPLHLSREYDGWVNRKLVDFYERYATTVFNRYKNKVKYWLTFNEINSILEAP
FMSGGISTPKDQLSEQDLYQAIHHELVASARAVKIGHQINPDFKIGCMVLSMPTYPLTPN
PDDVIAAMEFDHRNMAFADIHARGQYPGYMKRFFRENGISIHFEPGDAEDLKHTVDFISF
SYYMSTCETADEAKKTKGEGNILGGVSNPHLEASEWGWQIDPQGLRYVLNTFYDRFQKPL
FIVENGLGAVDELITNEQGEKTVEDDYRINYLNDHLVQVGEAIDDGVEVMGYTSWGCIDV
VSASTAQLKKRYGYIYVDRHDDGSGTLERYRKKSFHWYKEVIATNGQSLKR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacagtttccaaaagatttcctgtggggcggagcagttgctgctaaccagctc
gaaggcgcttatcaagaagatggaaaaggctggtctattcaggatgtaacccctcgtggt
ggttggggacccgttacggatgtgccaacagaagataatatgaagttgatcggtattgat
ttctatcacaaatataaagaagacattaaactttttgcagaaatgggtttcaaagtgttc
cggacttccatcgcttggtcacggatttttcctaaaggcgacgaactggaaccgaacgaa
caaggcttgcaattttatgatgatttgtttgatgaacttcacaaatatggaattgaacca
ctcgttacattatctcactatgaaacacctttacatctgtccagagaatacgatggttgg
gtgaaccgcaagcttgttgatttttatgagcgttatgctacaacggtatttaaccgctac
aaaaataaagtgaaatactggttgactttcaatgaaatcaactccattctggaagctcca
ttcatgagcggaggcattagcacacctaaagatcagcttagtgaacaagacctttatcaa
gccattcaccatgagcttgtagcaagtgcaagagcggtaaaaatcggtcatcagattaac
ccggatttcaaaatcggctgtatggtgctgagtatgcctacttatccgttgacacctaat
ccggacgatgtgattgctgcgatggaatttgaccacagaaatatggcgtttgctgatatt
catgccagaggtcaatacccaggctacatgaaacgtttctttagagaaaacggaatctct
attcactttgaaccaggcgatgcagaagatttgaagcatacggttgactttatctcgttc
agttattacatgagtacttgtgagacggctgacgaagctaaaaaaactaaaggtgaaggc
aacatcctcggtggtgtcagcaatccgcatcttgaggcaagcgagtggggctggcaaatc
gatcctcaaggattgcgttatgtgctgaacacgttctatgaccgtttccaaaaaccatta
ttcattgtggaaaatggtttgggcgccgttgacgaacttatcaccaacgaacaaggcgag
aaaaccgttgaagatgactaccggattaactatctgaatgatcatctggttcaagttggg
gaagccattgacgacggagtagaagttatgggctatacgtcttggggttgcatcgacgtt
gtcagtgcatcgaccgcacagcttaaaaaacgctatggttacatttatgtagatcgtcat
gatgacggtagcggcacacttgaaagataccggaaaaaatcgttccactggtacaaagag
gttattgccacgaatggccaaagccttaaacgttaa

DBGET integrated database retrieval system